Dataset for protein BCL-2-like of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6FJ57_BCL2L10      -----------------------MVDPFRERTARLLLDYLEFCAREPGA-
A0A8C6CUJ2_BCL2-01      ---------------------MAHAAGTGYDNREIVMKYIHYKLSQRGY-
A0A8C6DX24_BCL2L1-      ---------------------------MSQSNRELVVDFLSYKLSQKGY-
A0A8C6FN58_BCL2L1-      ---------------------------MSQSNWELVVDFLSYKLSQKGY-
A0A8C6MJ03_BCL2A1-      MFRQAPQA-------CASDCLGQ---LQVSRLKTLLPSKEKMTETEFGY-
A0A8C6CUC2_BCL2L2-      ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
A0A8C6E5E6_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
A0A8C6E5E6_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLVAGKEAAARREVGGG
                                                          :               

A0A8C6FJ57_BCL2L10      --------------------------------------------------
A0A8C6CUJ2_BCL2-01      --------------------------------------------------
A0A8C6DX24_BCL2L1-      --------------------------------------------------
A0A8C6FN58_BCL2L1-      --------------------------------------------------
A0A8C6MJ03_BCL2A1-      --------------------------------------------------
A0A8C6CUC2_BCL2L2-      --------------------------------------------------
A0A8C6E5E6_MCL1-02      --------------------------------------------------
A0A8C6E5E6_MCL1-01      EAGTVIGGSAGPSPPATLGPDARRVARPSPIGAEGPDVTATPTRLLFFAP
                                                                          

A0A8C6FJ57_BCL2L10      --------------------------------------------------
A0A8C6CUJ2_BCL2-01      ---------------------------------------------EWD--
A0A8C6DX24_BCL2L1-      ---------------------------------------------SWSQF
A0A8C6FN58_BCL2L1-      ---------------------------------------------IWSQF
A0A8C6MJ03_BCL2A1-      --------------------------------------------------
A0A8C6CUC2_BCL2L2-      --------------------------------------------------
A0A8C6E5E6_MCL1-02      --------------------------------------------------
A0A8C6E5E6_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPPVRPLPLLVGEAS
                                                                          

A0A8C6FJ57_BCL2L10      ----------------------------------------PAPAPSTPEA
A0A8C6CUJ2_BCL2-01      ---AGDAGAAPPGAAPAPGTLSAAPGRAPAPARTSPPPPAAAAGPAPSPV
A0A8C6DX24_BCL2L1-      SDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDA
A0A8C6FN58_BCL2L1-      SDMEENRTETTEGTESDMETLKAINGNPSWHLADSPAVKGATGHSRSLDA
A0A8C6MJ03_BCL2A1-      -----------------------VHRLAEDYLKYVLQIQQTGSRP-----
A0A8C6CUC2_BCL2L2-      ---------------------------------------VCGAGP-----
A0A8C6E5E6_MCL1-02      ---------------------------------------ATGAKDAKPLG
A0A8C6E5E6_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLG
                                                                          

A0A8C6FJ57_BCL2L10      AVLRHVAARVQEANRNVLPLYRRYRRHRVELVARMAQRLLDEDPG-----
A0A8C6CUJ2_BCL2-01      PPVVHLT-----LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
A0A8C6DX24_BCL2L1-      REVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQV
A0A8C6FN58_BCL2L1-      RKMIPVTTVKQALGQASNEFELRYQQTFSDLTSQLHITPGTAYQS-FEQV
A0A8C6MJ03_BCL2A1-      ------SKTSRVLQDVASSVQNEVERTLKQCLDKFDVVSVDTARTIFNQV
A0A8C6CUC2_BCL2L2-      GEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
A0A8C6E5E6_MCL1-02      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A8C6E5E6_MCL1-01      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
                                           .             .:               

A0A8C6FJ57_BCL2L10      ---------PSWGRVASLVTFAGSLLERPPQTTRRLEKRDDGGVSRDCRL
A0A8C6CUJ2_BCL2-01      VEELFRDG-VNWGRIVAFFEFGGVM-------CVESVNREMSP---LVDS
A0A8C6DX24_BCL2L1-      VNELFRDG-VNWGRIVAFFSFGGAL-------CVESVDKEMQV---LVSR
A0A8C6FN58_BCL2L1-      INELLRDG-VSWSRIVAFFSFGGAL-------CMKSIDKEMQV---LVSQ
A0A8C6MJ03_BCL2A1-      MEKEFEDGVVNWGRIVTIFAFEGIL-------IKKLQGKCIAPDMDMCKD
A0A8C6CUC2_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAAL-------CAESVNKEMEP---LVGQ
A0A8C6E5E6_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFV-------AKHLKSINQES---CIEP
A0A8C6E5E6_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFV-------AKHLKSINQES---CIEP
                                  .*.*:.::. * . :                         

A0A8C6FJ57_BCL2L10      LVALLCAQFCERHRAWLLANGGWD-GFCLSFSHSLQPSWERQLVWFFFSY
A0A8C6CUJ2_BCL2-01      IALWMTEYLNRHLHAWIQDNGGWD-AFVELYG-----PSMRPLFDFSWLS
A0A8C6DX24_BCL2L1-      IATWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFNRWF
A0A8C6FN58_BCL2L1-      VTTWMATYLNDHLEPWIQENGDWD-TFVELYENNTATESQKGQERFSCWS
A0A8C6MJ03_BCL2A1-      ISYFVAEFITENTGEWIRQNGGWENGFVKKFEIKSGWLTFLEVTGKICET
A0A8C6CUC2_BCL2L2-      VQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLREGNWASV
A0A8C6E5E6_MCL1-02      LAESITDVLVRSKRDWIVKQRGWD-GFVEFFHVEDL-------EGGIRNV
A0A8C6E5E6_MCL1-01      LAESITDVLVRSKRDWIVKQRGWD-GFVEFFHVEDL-------EGGIRNV
                        :   :   :      *:  . .*   *   :                   

A0A8C6FJ57_BCL2L10      WTAIII----------------------IYFWIKLS
A0A8C6CUJ2_BCL2-01      LKALLS-----------LALVGACITLGAYLGHK--
A0A8C6DX24_BCL2L1-      LTGMTV---------------AGVVLLGSLFSRK--
A0A8C6FN58_BCL2L1-      LMDMTVWYGSAGLAFQLIITIPFVIVIQILY-----
A0A8C6MJ03_BCL2A1-      LCRL-----------------------KQYY-----
A0A8C6CUC2_BCL2L2-      RTVLTG-----------AVALGALVTVGAFFASK--
A0A8C6E5E6_MCL1-02      LLAFAG-----------VAGVGA----GLAYLIR--
A0A8C6E5E6_MCL1-01      LLAFAG-----------VAGVGA----GLAYLIR--
                           :                                

© 1998-2022Legal notice