Dataset for protein BCL-2-like of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6E5E6_MCL1-01      -------------------MFGLKRNAVI-------GLNLYCGGAGLGQG
A0A8C6FJ57_BCL2L10      --MVDPFRERTARLLLDYLEFCAREPG-----------------------
A0A8C6CUJ2_BCL2-01      MAHAAGTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
A0A8C6DX24_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESD
A0A8C6FN58_BCL2L1-      ------MSQSNWELVVDFLSYKLSQKGYIWSQFSDMEENRTETTEGTESD
A0A8C6MJ03_BCL2A1-      -MFRQAPQACASDCLGQLQVSRLKTLLPS-------KEKMTETEFGYVHR
A0A8C6CUC2_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG-------------YVCGAGPGEG
A0A8C6E5E6_MCL1-02      -------------------MFGLKRNAVI-------GLNLYCGGAGLGQG
                                                                          

A0A8C6E5E6_MCL1-01      SGASSPGGRLLVAGKEAAARREVGGGEAGTVIGGSAGPSPPATLGPDARR
A0A8C6FJ57_BCL2L10      --------------------------------------------------
A0A8C6CUJ2_BCL2-01      PGTLSAAP------------------------------------------
A0A8C6DX24_BCL2L1-      METPSAIN------------------------------------------
A0A8C6FN58_BCL2L1-      METLKAIN------------------------------------------
A0A8C6MJ03_BCL2A1-      LAEDY---------------------------------------------
A0A8C6CUC2_BCL2L2-      PAADP---------------------------------------------
A0A8C6E5E6_MCL1-02      SGASSPGG------------------------------------------
                                                                          

A0A8C6E5E6_MCL1-01      VARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEE
A0A8C6FJ57_BCL2L10      --------------------------------------------------
A0A8C6CUJ2_BCL2-01      --------------------------------------------------
A0A8C6DX24_BCL2L1-      --------------------------------------------------
A0A8C6FN58_BCL2L1-      --------------------------------------------------
A0A8C6MJ03_BCL2A1-      --------------------------------------------------
A0A8C6CUC2_BCL2L2-      --------------------------------------------------
A0A8C6E5E6_MCL1-02      --------------------------------------------------
                                                                          

A0A8C6E5E6_MCL1-01      LDGCEPDPLGKRPPVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDEL
A0A8C6FJ57_BCL2L10      --------------------------------------------------
A0A8C6CUJ2_BCL2-01      --------------------------------------------------
A0A8C6DX24_BCL2L1-      --------------------------------------------------
A0A8C6FN58_BCL2L1-      --------------------------------------------------
A0A8C6MJ03_BCL2A1-      --------------------------------------------------
A0A8C6CUC2_BCL2L2-      --------------------------------------------------
A0A8C6E5E6_MCL1-02      --------------------------------------------------
                                                                          

A0A8C6E5E6_MCL1-01      YRQSLEIISQYLREQATGAKDAKPLGGSGATSRKA-----------LETL
A0A8C6FJ57_BCL2L10      --------------------------APAPAPSTPEAAVLRHVAARVQEA
A0A8C6CUJ2_BCL2-01      ------------GRAPAPARTSPPPPAAAAGPAPSPVPPVVHLT-----L
A0A8C6DX24_BCL2L1-      ------------GNPSWHLADSPAVNGATGHSRSLDAREVIPMAAVKQAL
A0A8C6FN58_BCL2L1-      ------------GNPSWHLADSPAVKGATGHSRSLDARKMIPVTTVKQAL
A0A8C6MJ03_BCL2A1-      ------------------LKYVLQIQQTGSRPSKT-----------SRVL
A0A8C6CUC2_BCL2L2-      ----------------------------------L-----------HQAM
A0A8C6E5E6_MCL1-02      ------------RLLATGAKDAKPLGGSGATSRKA-----------LETL
                                                                          

A0A8C6E5E6_MCL1-01      RRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWG
A0A8C6FJ57_BCL2L10      NRNVLPLYRRYRRHRVELVARMAQRLLDEDPG--------------PSWG
A0A8C6CUJ2_BCL2-01      RQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVVEELFRDG-VNWG
A0A8C6DX24_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFRDG-VNWG
A0A8C6FN58_BCL2L1-      GQASNEFELRYQQTFSDLTSQLHITPGTAYQS-FEQVINELLRDG-VSWS
A0A8C6MJ03_BCL2A1-      QDVASSVQNEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGVVNWG
A0A8C6CUC2_BCL2L2-      RAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGG-PNWG
A0A8C6E5E6_MCL1-02      RRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWG
                              .             .:                         .*.

A0A8C6E5E6_MCL1-01      RIVTLISFGAFV-------AKHLKSINQES---CIEPLAESITDVLVRSK
A0A8C6FJ57_BCL2L10      RVASLVTFAGSLLERPPQTTRRLEKRDDGGVSRDCRLLVALLCAQFCERH
A0A8C6CUJ2_BCL2-01      RIVAFFEFGGVM-------CVESVNREMSP---LVDSIALWMTEYLNRHL
A0A8C6DX24_BCL2L1-      RIVAFFSFGGAL-------CVESVDKEMQV---LVSRIATWMATYLNDHL
A0A8C6FN58_BCL2L1-      RIVAFFSFGGAL-------CMKSIDKEMQV---LVSQVTTWMATYLNDHL
A0A8C6MJ03_BCL2A1-      RIVTIFAFEGIL-------IKKLQGKCIAPDMDMCKDISYFVAEFITENT
A0A8C6CUC2_BCL2L2-      RLVAFFVFGAAL-------CAESVNKEMEP---LVGQVQEWMVAYLETRL
A0A8C6E5E6_MCL1-02      RIVTLISFGAFV-------AKHLKSINQES---CIEPLAESITDVLVRSK
                        *:.::. * . :                         :   :   :    

A0A8C6E5E6_MCL1-01      RDWIVKQRGWD-GFVEFFHVEDL-------EGGIRNVLLAFAG-------
A0A8C6FJ57_BCL2L10      RAWLLANGGWD-GFCLSFSHSLQPSWERQLVWFFFSYWTAIII-------
A0A8C6CUJ2_BCL2-01      HAWIQDNGGWD-AFVELYG-----PSMRPLFDFSWLSLKALLS-------
A0A8C6DX24_BCL2L1-      EPWIQENGGWD-TFVELYGNNAAAESRKGQERFNRWFLTGMTV-------
A0A8C6FN58_BCL2L1-      EPWIQENGDWD-TFVELYENNTATESQKGQERFSCWSLMDMTVWYGSAGL
A0A8C6MJ03_BCL2A1-      GEWIRQNGGWENGFVKKFEI----------KSGWLTFLEVTGK-------
A0A8C6CUC2_BCL2L2-      ADWIHSSGGWA-EFTALYGDGALEEARRLREGNWASVRTVLTG-------
A0A8C6E5E6_MCL1-02      RDWIVKQRGWD-GFVEFFHVEDL-------EGGIRNVLLAFAG-------
                          *:  . .*   *   :                                

A0A8C6E5E6_MCL1-01      ----VAGVGA----GLAYLIR--
A0A8C6FJ57_BCL2L10      ---------------IYFWIKLS
A0A8C6CUJ2_BCL2-01      ----LALVGACITLGAYLGHK--
A0A8C6DX24_BCL2L1-      --------AGVVLLGSLFSRK--
A0A8C6FN58_BCL2L1-      AFQLIITIPFVIVIQILY-----
A0A8C6MJ03_BCL2A1-      ----ICE--TLCRLKQYY-----
A0A8C6CUC2_BCL2L2-      ----AVALGALVTVGAFFASK--
A0A8C6E5E6_MCL1-02      ----VAGVGA----GLAYLIR--
                                               

© 1998-2023Legal notice