Dataset for protein BCL-2-like of organism Microcebus murinus

[Download (right click)] [Alignment] [Repertoires]

15 sequence(s)

>gnl|bcl2dbpro|A0A8B7FJ73_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8B7FJ73_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L2 (length=270 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPGDQEEEEEPGLVEGDPGDGAIED
PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
SVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSS
RSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A8B7FJ73_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L2 (length=306 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPGELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A8B7FJ73_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A8B7FNN3_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPPVNGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B7FNN3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPPVNGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B7FNN3_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPPVNGATGHSSSLDAREV
IPMAAVKQALKEAGDEFELRYRRAFSDLTSQLHITLATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B7FNN3_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L1 (length=145 residues).
MQKKIGLRPQKGLNRRWRPPVPLMATHPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEAGTVIGGSPGASPPASLTPDARRVARPA
PIGAEVPDVTATPERLLFFAPTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSGTEGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A8B7GKA0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGGGEAGTVIGGSPGASPPASLTPDARRVARPA
PIGAEVPDVTATPERLLFFAPTRRAVPPEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEASNGSGTEGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSGAASRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8B7H1C6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Microcebus murinus GN=BCL-2 (length=236 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEASAAPPGAVPAPGIFSSQPGGTPPPAAPRDPAARTSPPAAHAAAAG
PALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C5VB12_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Microcebus murinus GN=BCL2A1 (length=186 residues).
MKQLQTLLPAGRKMTGCEFEFTRELAQDYLQHVLRAPQPGSSPSEASRVLRSVASSVQNEVERRLEPCLDNFNVASVETA
RAIFSRVMEQEFGDGVVNWGRVVTVFAFGGVLTKRLLRERAALDPDACKQISHLIAEFVVSHTGEWIRQNGGWEHGFVKK
FEPRPAWLTFLEVLGKVCGVLSLLHY
>gnl|bcl2dbpro|A0A8C5VC33_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Microcebus murinus GN=MCL-1 (length=141 residues).
LCVLYLSCGKKDPMCFFLCLVRNDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVAAGLAYLIDSLVCAVMGF
>gnl|bcl2dbpro|A0A8C5XEX1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Microcebus murinus GN=BCL2L10 (length=192 residues).
MGDLFRERTERLLADYLEYCAREPGTPGLPPSSLEAAALRLAATKIRQKHASFFSAYVGYPGNRVSLMERMAEAVLSDSL
SWGRVVMLLTFAGTLLERGPRVTAWWRKWDLKPQLKEGDPEVARDCQRLVALLSAWLAGQHRAWLQAQGGWDGFCDLFRK
PLPLAVWRRLLAQVLLSCFLATTVIYFWTRLL
© 1998-2022Legal notice