Dataset for protein BCL-2-like of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      -------------------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAE
A0A8B7FNN3_BCL2L1-      -------------------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAE
A0A8B7FNN3_BCL2L1-      -------------------MSQSNRELVVDFLSYKLSQKGYSWSQFIDAE
A0A8B7H1C6_BCL2-01      -------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW----DAG
A0A8B7FJ73_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCG----AG--------PGEGPA
A0A8B7GKA0_MCL1-01      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPP
A0A8B7GKA0_MCL1-02      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPP
A0A8B7FJ73_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCG----AG--------PGEGPA
A0A8B7FJ73_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGDY
A0A8B7FJ73_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPG----AGGEAGEGAPGGAGDY
A0A8B7GKA0_MCL1-03      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSSGATPP
A0A8C5VB12_BCL2A1-      --MKQLQTLLPAGRKMTGCEFEFTRELAQDYLQHV---------------
A0A8C5XEX1_BCL2L10      --MGDLFR-------------ERTERLLADYLEYC---------------
                                                                          

A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      ENRTEAPEGTESE-------------------------------------
A0A8B7FNN3_BCL2L1-      ENRTEAPEGTESE-------------------------------------
A0A8B7FNN3_BCL2L1-      ENRTEAPEGTESE-------------------------------------
A0A8B7H1C6_BCL2-01      EASAAPPGAVPAP-------------------------------------
A0A8B7FJ73_BCL2L2-      ADPLHQAMRAAGD----------EFETRFRRTFSDLAAQLHVTPGSAQQR
A0A8B7GKA0_MCL1-01      GGRLLAAEKEATA---------------------------------RREV
A0A8B7GKA0_MCL1-02      GGRLLAAEKEATA---------------------------------RREV
A0A8B7FJ73_BCL2L2-      ADPLHQAMRAAGD----------EFETRFRRTFSDLAAQLHVTPGSAQQR
A0A8B7FJ73_BCL2L2-      GNGLESEELEPGD------------------------------------Q
A0A8B7FJ73_BCL2L2-      GNGLESEELEPGELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQ
A0A8B7GKA0_MCL1-03      GGRLLATGAKDAK-------------------------------------
A0A8C5VB12_BCL2A1-      -----------LR-------------------------------------
A0A8C5XEX1_BCL2L10      -----------AR-------------------------------------
                                                                          

A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --METPSAINGNPSWHLADSPPVNGATGHSSSLD----------------
A0A8B7FNN3_BCL2L1-      --METPSAINGNPSWHLADSPPVNGATGHSSSLD----------------
A0A8B7FNN3_BCL2L1-      --METPSAINGNPSWHLADSPPVNGATGHSSSLD----------------
A0A8B7H1C6_BCL2-01      --GIFSSQPGGTPPPAAPRDPAARTSPPAAHAAA----------------
A0A8B7FJ73_BCL2L2-      FTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVA
A0A8B7GKA0_MCL1-01      GGGEAGTVIGGSPGAS----------------------------------
A0A8B7GKA0_MCL1-02      GGGEAGTVIGGSPGAS----------------------------------
A0A8B7FJ73_BCL2L2-      FTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVA
A0A8B7FJ73_BCL2L2-      EEEEEPGLVEGDPGDGAI--------------------------------
A0A8B7FJ73_BCL2L2-      EEEEEPGLVEGDPGDGAI--------------------------------
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8C5VB12_BCL2A1-      --------------------------------------------------
A0A8C5XEX1_BCL2L10      --------------------------------------------------
                                                                          

A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7H1C6_BCL2-01      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      YLETRLADWIHSSGGW------------AEFTALYGDGALEEARRLR---
A0A8B7GKA0_MCL1-01      -------------PPASLTPDARRVARPAPIGAEVPDVTATPERLLFFAP
A0A8B7GKA0_MCL1-02      -------------PPASLTPDARRVARPAPIGAEVPDVTATPERLLFFAP
A0A8B7FJ73_BCL2L2-      YLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A8B7FJ73_BCL2L2-      -------------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A8B7FJ73_BCL2L2-      -------------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8C5VB12_BCL2A1-      --------------------------------------------------
A0A8C5XEX1_BCL2L10      --------------------------------------------------
                                                                          

A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7H1C6_BCL2-01      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      -------------EGNWASVRTVLTGAVALGALVT---------------
A0A8B7GKA0_MCL1-01      TRRAVPP------EEMEAPAADAIM------SPEDELDGYEPEPLGKRPA
A0A8B7GKA0_MCL1-02      TRRAVPP------EEMEAPAADAIM------SPEDELDGYEPEPLGKRPA
A0A8B7FJ73_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A8B7FJ73_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A8B7FJ73_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRV
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8C5VB12_BCL2A1-      --------------------------------------------------
A0A8C5XEX1_BCL2L10      --------------------------------------------------
                                                                          

A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8C5VC33_MCL1-01      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7FNN3_BCL2L1-      --------------------------------------------------
A0A8B7H1C6_BCL2-01      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-01      VLPLLELVGEASNGSGTEGSLPSTPPPAEEEEDELYR-QSLEIISRYLRE
A0A8B7GKA0_MCL1-02      VLPLLELVGEASNGSGTEGSLPSTPPPAEEEEDELYR-QSLEIISRYLRE
A0A8B7FJ73_BCL2L2-      TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
A0A8B7FJ73_BCL2L2-      TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
A0A8B7FJ73_BCL2L2-      TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
A0A8B7GKA0_MCL1-03      --------------------------------------------------
A0A8C5VB12_BCL2A1-      --------------------------------------------------
A0A8C5XEX1_BCL2L10      --------------------------------------------------
                                                                          

A0A8B7FNN3_BCL2L1-      -------------------------MQKKIGLRPQKGLNRRWRPPVPLMA
A0A8C5VC33_MCL1-01      --------------------------------LCVLYLSCGKKDPMCFFL
A0A8B7FNN3_BCL2L1-      ----------AREVIPMA--AVKQALKEAGDEFE-LRYRRAFSDLTSQLH
A0A8B7FNN3_BCL2L1-      ----------AREVIPMA--AVKQALKEAGDEFE-LRYRRAFSDLTSQLH
A0A8B7FNN3_BCL2L1-      ----------AREVIPMA--AVKQALKEAGDEFE-LRYRRAFSDLTSQLH
A0A8B7H1C6_BCL2-01      ----------AGPALSPVPPVVHLTLRQAGDDFS-RRYRRDFAEMSSQLH
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-01      QATGAKDAK-PMGRSGAASRKALETLRRVGDGVQ-RNHQTAFQGWVCGV-
A0A8B7GKA0_MCL1-02      QATGAKDAK-PMGRSGAASRKALETLRRVGDGVQ-RNHQTAFQGMLRKLD
A0A8B7FJ73_BCL2L2-      PGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR---
A0A8B7FJ73_BCL2L2-      PGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR---
A0A8B7FJ73_BCL2L2-      PGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRAR---
A0A8B7GKA0_MCL1-03      ----------PMGRSGAASRKALETLRRVGDGVQRNHQTAFQGMLRKLDI
A0A8C5VB12_BCL2A1-      ----------AP-QPGSSPSEASRVLRSVASSVQNEVERRLEPCLDNFNV
A0A8C5XEX1_BCL2L10      ----------EPGTPGLPPSS----LEAAALRLAATKIRQKHASFFSAYV
                                                                          

A0A8B7FNN3_BCL2L1-      THPATAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGALCVE---------
A0A8C5VC33_MCL1-01      CLVRNDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH---------
A0A8B7FNN3_BCL2L1-      ITLATAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE---------
A0A8B7FNN3_BCL2L1-      ITLATAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE---------
A0A8B7FNN3_BCL2L1-      ITLATAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE---------
A0A8B7H1C6_BCL2-01      LTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVE---------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-01      ----------------LPCRGPRRW-------------------------
A0A8B7GKA0_MCL1-02      IKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH---------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-03      KNEDDVKSL-SRVMVHVFSDGVTNWGRIVTLISFGAFVAKH---------
A0A8C5VB12_BCL2A1-      ASVETARAIFSRVMEQEFGDGVVNWGRVVTVFAFGGVLTKR---------
A0A8C5XEX1_BCL2L10      GYPGNRVSLMERMAEAVLSDS-LSWGRVVMLLTFAGTLLERGPRVTAWWR
                                                                          

A0A8B7FNN3_BCL2L1-      ---------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-TFVE
A0A8C5VC33_MCL1-01      ---------LKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-GFVE
A0A8B7FNN3_BCL2L1-      ---------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-TFVE
A0A8B7FNN3_BCL2L1-      ---------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-TFVE
A0A8B7FNN3_BCL2L1-      ---------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD-TFVE
A0A8B7H1C6_BCL2-01      ---------SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWD-AFVE
A0A8B7FJ73_BCL2L2-      ----------------------------------------VGAFF-ASK-
A0A8B7GKA0_MCL1-01      --------------HQKCAAGFCRCC----------W---SRSWF-GISN
A0A8B7GKA0_MCL1-02      ---------LKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-GFVE
A0A8B7FJ73_BCL2L2-      ----------------------------------------ATSWY-SPY-
A0A8B7FJ73_BCL2L2-      ----------------------------------------ATSWY-SPY-
A0A8B7FJ73_BCL2L2-      ----------------------------------------ATSWY-SPY-
A0A8B7GKA0_MCL1-03      ---------LKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-GFVE
A0A8C5VB12_BCL2A1-      ------LLRERAALDPDACKQISHLIAEFVVSHTGEWIRQNGGWEHGFVK
A0A8C5XEX1_BCL2L10      KWDLKPQLKEGDPEVARDCQRLVALLSAWLAGQHRAWLQAQGGWD-GFCD
                                                                  .:      

A0A8B7FNN3_BCL2L1-      LYGNNAAAESRKGQERFN------RWFLTGMTVAGVV-----LLGSLFSR
A0A8C5VC33_MCL1-01      FF----HVEDLEGGIRNV------LLAFAG--VAGVAAGLAYLIDSLVCA
A0A8B7FNN3_BCL2L1-      LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----
A0A8B7FNN3_BCL2L1-      LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----
A0A8B7FNN3_BCL2L1-      LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK----
A0A8B7H1C6_BCL2-01      LYGPNM-------RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK----
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-01      KIAL----------------------------------------------
A0A8B7GKA0_MCL1-02      FFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLIR-----
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7FJ73_BCL2L2-      --------------------------------------------------
A0A8B7GKA0_MCL1-03      FFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLIR-----
A0A8C5VB12_BCL2A1-      KFE---PRPAWL------------TFLEVLGKVCGVLSLLHY--------
A0A8C5XEX1_BCL2L10      LFRKPLPLAVWR------------RLLAQVLLSCFLATTVIYFWTRLL--
                                                                          

A0A8B7FNN3_BCL2L1-      K---
A0A8C5VC33_MCL1-01      VMGF
A0A8B7FNN3_BCL2L1-      ----
A0A8B7FNN3_BCL2L1-      ----
A0A8B7FNN3_BCL2L1-      ----
A0A8B7H1C6_BCL2-01      ----
A0A8B7FJ73_BCL2L2-      ----
A0A8B7GKA0_MCL1-01      ----
A0A8B7GKA0_MCL1-02      ----
A0A8B7FJ73_BCL2L2-      ----
A0A8B7FJ73_BCL2L2-      ----
A0A8B7FJ73_BCL2L2-      ----
A0A8B7GKA0_MCL1-03      ----
A0A8C5VB12_BCL2A1-      ----
A0A8C5XEX1_BCL2L10      ----
                            

© 1998-2022Legal notice