Dataset for protein BCL-2-like of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  maqlqaaaagaagdfvgys-l-k--l--lnlhalsaglgagpqfidaeegptlsamrtpa-          pe epp 
  akdaftllp grkmt rgpl-tehyapkfiq -  ea ega p etdyadgahqeglae-r                 
   g   r     m ha ctkefr gi c   h v   r  e  g    a as apt kvdta                 
                   egydq r  q   e                g        ak lp                 
                            m                                 k                 

        90       100       110       120       130       140       150       160
prappg pgpgpgs aaqerfggvsgtavg s sdhai                                          
                pgsqeeqiedgvfq g nas                                            
                      e aseqpe d ppa                                            
                        f      t                                                

       170       180       190       200       210       220       230       240
   ggps tpdar  arpapigaevpdvtatpakllffa trravp        enw pvadaim a al sped  dgy
   eda              ft lyg gal e  r r                 g   s  tvlt       lvt     

       250       260       270       280       290       300       310       320
epeplgkrpavlpllelv easngsgt g lpstpppaeeeede y  qsleladkrpnnggishssrgd-mevsrmrsr
                                                    a rd aa t    a  a  gpqpsps p
                                                                         al lp  

       330       340       350       360       370       380       390       400
kalqs-k-f---lev-nlq---q-pvclyvtylendvsllsqmmvhvpsrspts   v tlit aafvakh         
aykeam-s-als--rt-h-qrwasm--fvllsvrdvrkrmat aeqelg   rr     mvle   vmter         
v srv qqkigrrsqny-tclq-p-spkniknng rkgi      a  c   l         a   t l           
s hl  ek   l pnkvqsakkpmwrngmdglef   a                                          
e      a   d caekin ghkefmkafack d                                              
             a  he  fegc l  d ah                                                
                g   d    f                                                      

       410       420       430       440       450       460       470       480
      l klksinqescieplvesitdvvvdtked lvkata f sssnf-hvedpeggwr rplnv      nvffal
         ernrlvsrdcqqfsrllsew asqtht  rqv   e aikkkirppmlvpvil gi  d      tlaevf
          gap hppaakn clcc af  g hge   ds       cd  el lhradle            lt asv
            a dak  dg  h           a   a            ak   l a              kf  q 
                d  a   a                                                        

       490       500    
alscflgaggslfits lcak   
lg gacattvi  whr f      
gk    ls  h  lg         
      i      gd         
© 1998-2023Legal notice