Dataset for protein Mcl-1 of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A4W5KYB3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=254 residues).
MYHVPHTVDKHKCWTCKLEIDSFVENDTLLGEHIYHVYNTGGHCRYLADRYTNREEEIMLILGKERYRKGTVAFPETMET
CDALDTDTRQLMTCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRD
GTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRNIIATLV
GLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5LF91_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=221 residues).
MYHVPHTVDKHKCWTCKLEIDSFVENDTLLGEHIYHTHTMKISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKAL
STMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEA
VGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5LP06_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=292 residues).
MSLSVTRATTTMWHYQNGVFGPSYSAGASPLCYFATGAVCPGASPKSKVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNH
LSDLSNNDDSGDSLPCTPEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKALTTMKRVVKDVIAK
HRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTTNWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQ
RDWLVKNNAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A4W5LP06_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=349 residues).
MSLSVTRATTTMWHYQNGVFGPSYSAGASPLCYFATGAVCPGASPKSKVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNH
LSDLSNNDDSGDSLPCTPEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKALTTMKRVVKDVIAK
HRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTTNWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQ
RDWLVKNNAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRSHHPSLLSSAVFELSPLIMNEERRLISSEAPL
SDSFPDGNAIYRSVLDSLFYKAKGLGCCR
>gnl|bcl2dbpro|A0A4W5LZB2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=194 residues).
MNNTHGVACTHTMKISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYM
DDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKHNSWNGFV
EFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5Q5Q2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=262 residues).
METAKRKTLLSLFDGTGSICKPFVEAGWTVRRLDIDSRHGADIVVDIRKWDPLDSVSARARMNNTHGVACVYKCQRCKGI
LSSCELETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVST
LAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAEPESRS
RNIIATLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A4W5Q5Q2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=201 residues).
ADKVTVNRARAGDNGNSQAENISHQETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNG
MINTLYMYDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKH
NSWNGFVEFFSVAEPESRSRNIIATLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A4W5QGT1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=283 residues).
MSLSKSIARATTTMLHFQNGGSSYLANDASPLCYFNGAGASPTSKVDLGNGTGDTPPRPTTLGVSVVKSNVLDNHLSDRS
NNDDSDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIEHFLRDYTGLSQPRWKQSKPLTTMKRVVEDVIAKHRYAF
NGMIAKLDLDDRCDDMRVINSVAKTMFGDRVTNWGRIASLVAFGAVVSQHLKENGRGHCVDLVGQEIATYLLSDQRDWLV
KNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIR
© 1998-2020Legal notice