Dataset for protein Mcl-1 of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------m-h-qngv---------as---yf-wt----gadskskvdtdlgngtgdtppr-----------nvl
msmslsvtrattt-y-y----fgpsysagd-kplc--c--cvkl-ispfven--l--eh-yh----pttlgvnnvksg--
  letakrktllslwdvphti  s  l n d- fvhkatgarcpe-------ri-vd--i--vyttvsararmgnth-ga
    k ia      l gtgs          c    eangav r d  kvtva ava irkwnsqns      sv     h
              f f                    g          thg   r  dn   pldm              
                                                r              hae              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   .  :.*: ****::  .* :**** :  *::**.*:**.*** ::
cnhlsdrs----------------------lsnhqetcdaLdtDTRQlitcvLgqYTGLlkrgWneSKaLsTMsRVVgql
--------nnddsgdslpctpemasecgpe-iscpsadev eh    vmedl rd    sqpr kq  p t  k   kdv
gvytmqlyt reeeim ilgkqryrkgtvss-e-m            khf                         e  
dt kckic     d             ilanp-tl                                             
 r  a                         kc                                                
                              f                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ****::**** .* : ** **: .:.::*: :* * ..****:***.:***.*.* **: .*.:*:  **:**::**:
leKHRYtyNGMIntLymdDRgDDvrfvstlAhiiFrDgtvNWGRvASLtsFGAaVcQyLKdegRdnCvelVGeEIsaYLv
ia    af    ak dly  c  msviksv ktl s rvt    i   va   v s q  ers gh iga  q  at  l
                           n     m g                     h   n                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :.*****:*:*****:** * :.**  ** : ::.*.*****::::*                               
thhkDWLVKhNsWNGFVeFFsVaepESrsRNiiatlvGlAGIGAamtlLim-----------------------------
sdqr     n a     d  h qdt  sv  tllafa f     tlam arsshpsllssavfelsplimneerrlisse
                                      v          v nhad                         
                                                                                
                                                                                
                                                                                

       330       340       350  
....:....|....:....|....:....|..
                                
--------------------------------
aplsdsfpdgnaiyrsvldslfykakglgccr
                                
                                
                                
                                
© 1998-2020Legal notice