Dataset for protein Mcl-1 of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .  
-------------m-h-qng----------asp--yf-------gasp-skvd-dlgngtgdtpprpttlgvnnvksgvl
msmslsvtrattt-w-y---vfgpsysagd---lc--awtavcp----k----t----------d-------mgnthnna
  letakrktllslydvthti  s  l n dk fvhkntgvrrleidstvgn ivvdirkyhvy-tvsvrrr----- gs
    k ia      l gpgs          c    eaggac k d   rhea  l  ehiw plns  anaasvgdn  h
              f f                    c          f              a k      ra      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                             .  :.*: ****::  .* :**** :  *::**.*:**.*** ::
cnhlsdrs-n------l--------ecgpelsncpetcdaLdtDTRQliecvLgqYTGLlkrgWneSKaLsTMsRVVgql
gvytmsl-n-ddsgds-pctpemas--------hqsadev eh    vmtdl rd    sqpr kq  p t  k   kdv
qteniq-yt reeeim ilgkqryrkgtvsspe-m            khf                         e  
dr kckic     d             ilafc tl                                             
 a  a                                                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ****::**** .* : ** **: .:.::*: :* * ..****:***.:***.*.* **: .*.:*:  **:**::**:
leKHRYtyNGMIntLymdDRgDDvrfvstlAhiiFrDgtvNWGRvASLtsFGAaVcQyLKdegRdnCvelVGeEIsaYLv
ia    af    ak dly  c  msviksv ktl s rvt    i   va   v s q  ers gh iga  q  at  l
                           n     m g                     h   n                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :.*****:*:*****:** * :.**  ** : ::.*.*****::::*                               
thhkDWLVKhNsWNGFVeFFsVaepESrsRNiiatlvGlAGIGAamtlLim-----------------------------
sdqr     n a     d  h qdt  sv  tllafa f     tlam vrsshpsllssavfelsplimneerrlisse
                                      v          a nhad                         
                                                                                
                                                                                

       330       340       350  
....:....|....:....|....:....|..
                                
--------------------------------
aplsdsfpdgnaiyrsvldslfykakglgccr
                                
                                
                                
© 1998-2023Legal notice