Dataset for protein Mcl-1 of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5QGT1_MCL1-01      MSLSKSIARATTTMLHFQNG--GSSYLANDASPLCYFNGA----GASPTS
A0A4W5LP06_MCL1-01      --MSLSVTRATTTMWHYQNGVFGPSYSAG-ASPLCYFATGAVCPGASPKS
A0A4W5LP06_MCL1-02      --MSLSVTRATTTMWHYQNGVFGPSYSAG-ASPLCYFATGAVCPGASPKS
A0A4W5LF91_MCL1-01      -------------MYHVPHTV---------DK---HKCWTC-KLEIDSFV
A0A4W5Q5Q2_MCL1-01      ---------------------------------------------ADKVT
A0A4W5LZB2_MCL1-01      --------------------------------------------------
A0A4W5KYB3_MCL1-01      -------------MYHVPHTV---------DK---HKCWTC-KLEIDSFV
A0A4W5Q5Q2_MCL1-02      --METAKRKTLLSLFDGTGSI---------CKPFVEAGWTVRRLDIDSRH
                                                                          

A0A4W5QGT1_MCL1-01      KV--DLGNGTGDTPPRPTTLGVSVVKSNVLDNHLSDRSNNDDSDDSLPCT
A0A4W5LP06_MCL1-01      KVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNHLSDLSNNDDSGDSLPCT
A0A4W5LP06_MCL1-02      KVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNHLSDLSNNDDSGDSLPCT
A0A4W5LF91_MCL1-01      ENDTLLGEHIYHTHTM----------------------------------
A0A4W5Q5Q2_MCL1-01      VNRARAGDN-GNSQAE----------------------------------
A0A4W5LZB2_MCL1-01      ----------------------MNNTHGVACTHTMKIS------------
A0A4W5KYB3_MCL1-01      ENDTLLGEHIYHVYNT-----------GGHCRYLADRYTNREEEIMLILG
A0A4W5Q5Q2_MCL1-02      GADIVVDIRKWDPLDSVSARARMNNTHGVACVYKCQRC------------
                                                                          

A0A4W5QGT1_MCL1-01      PQMASECGPELSNCPSGDEVLEHDTRQLIEHFLRDYTGLSQPRWKQSKPL
A0A4W5LP06_MCL1-01      PEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKAL
A0A4W5LP06_MCL1-02      PEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKAL
A0A4W5LF91_MCL1-01      ----------KISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKAL
A0A4W5Q5Q2_MCL1-01      ----------NISHQETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKAL
A0A4W5LZB2_MCL1-01      -------------HQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKAL
A0A4W5KYB3_MCL1-01      KERYRKGTVAFPETMETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKAL
A0A4W5Q5Q2_MCL1-02      -----KGILSSCE-LETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKAL
                                       .  :.*: ****::  .* :**** :  *::**.*

A0A4W5QGT1_MCL1-01      TTMKRVVEDVIAKHRYAFNGMIAKLDLDDRCDDMRVINSVAKTMFGDRVT
A0A4W5LP06_MCL1-01      TTMKRVVKDVIAKHRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTT
A0A4W5LP06_MCL1-02      TTMKRVVKDVIAKHRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTT
A0A4W5LF91_MCL1-01      STMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRDGTV
A0A4W5Q5Q2_MCL1-01      STMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVSTLAHIIFRDGTV
A0A4W5LZB2_MCL1-01      STMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRDGTV
A0A4W5KYB3_MCL1-01      STMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRDGTV
A0A4W5Q5Q2_MCL1-02      STMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVSTLAHIIFRDGTV
                        :**.*** ::: ****::**** .* : ** **: .:.::*: :* * ..

A0A4W5QGT1_MCL1-01      NWGRIASLVAFGAVVSQHLKENGRGHCVDLVGQEIATYLLSDQRDWLVKN
A0A4W5LP06_MCL1-01      NWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQRDWLVKN
A0A4W5LP06_MCL1-02      NWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQRDWLVKN
A0A4W5LF91_MCL1-01      NWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKH
A0A4W5Q5Q2_MCL1-01      NWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKH
A0A4W5LZB2_MCL1-01      NWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKH
A0A4W5KYB3_MCL1-01      NWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKH
A0A4W5Q5Q2_MCL1-02      NWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKH
                        ****:***.:***.*.* **: .*.:*:  **:**::**:: :.*****:

A0A4W5QGT1_MCL1-01      NAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIR---------
A0A4W5LP06_MCL1-01      NAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRNSAD-----
A0A4W5LP06_MCL1-02      NAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRSHHPSLLSS
A0A4W5LF91_MCL1-01      NSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM---------
A0A4W5Q5Q2_MCL1-01      NSWNGFVEFFSVAEPESRSRNIIATLVGLAGIGAAMTLLVM---------
A0A4W5LZB2_MCL1-01      NSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM---------
A0A4W5KYB3_MCL1-01      NSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM---------
A0A4W5Q5Q2_MCL1-02      NSWNGFVEFFSVAEPESRSRNIIATLVGLAGIGAAMTLLVM---------
                        *:*****:** * :.**  ** : ::.*.*****::::*           

A0A4W5QGT1_MCL1-01      --------------------------------------------------
A0A4W5LP06_MCL1-01      --------------------------------------------------
A0A4W5LP06_MCL1-02      AVFELSPLIMNEERRLISSEAPLSDSFPDGNAIYRSVLDSLFYKAKGLGC
A0A4W5LF91_MCL1-01      --------------------------------------------------
A0A4W5Q5Q2_MCL1-01      --------------------------------------------------
A0A4W5LZB2_MCL1-01      --------------------------------------------------
A0A4W5KYB3_MCL1-01      --------------------------------------------------
A0A4W5Q5Q2_MCL1-02      --------------------------------------------------
                                                                          

A0A4W5QGT1_MCL1-01      --
A0A4W5LP06_MCL1-01      --
A0A4W5LP06_MCL1-02      CR
A0A4W5LF91_MCL1-01      --
A0A4W5Q5Q2_MCL1-01      --
A0A4W5LZB2_MCL1-01      --
A0A4W5KYB3_MCL1-01      --
A0A4W5Q5Q2_MCL1-02      --
                          

© 1998-2020Legal notice