Dataset for protein BCL-2-like of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|A0A4W5JPK5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNNRNSRSNLAKPSSPQGGMEAVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDRFAKIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A4W5KV00_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNELMISPRPGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A4W5KYB3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=254 residues).
MYHVPHTVDKHKCWTCKLEIDSFVENDTLLGEHIYHVYNTGGHCRYLADRYTNREEEIMLILGKERYRKGTVAFPETMET
CDALDTDTRQLMTCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRD
GTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRNIIATLV
GLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5LF91_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=221 residues).
MYHVPHTVDKHKCWTCKLEIDSFVENDTLLGEHIYHTHTMKISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKAL
STMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEA
VGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5LP06_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=349 residues).
MSLSVTRATTTMWHYQNGVFGPSYSAGASPLCYFATGAVCPGASPKSKVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNH
LSDLSNNDDSGDSLPCTPEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKALTTMKRVVKDVIAK
HRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTTNWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQ
RDWLVKNNAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRSHHPSLLSSAVFELSPLIMNEERRLISSEAPL
SDSFPDGNAIYRSVLDSLFYKAKGLGCCR
>gnl|bcl2dbpro|A0A4W5LP06_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=292 residues).
MSLSVTRATTTMWHYQNGVFGPSYSAGASPLCYFATGAVCPGASPKSKVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNH
LSDLSNNDDSGDSLPCTPEMASECGPELSNCPSADEVLEHDTRQVIEDLLGDYTGLSQPRWKESKALTTMKRVVKDVIAK
HRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSDGTTNWGRIASLVAFGAVVSQQLKERSRGHCIGLVGQEIATYLLSDQ
RDWLVKNNAWNGFVDFFHVQDPESSVRNTLLAFAGFAGIGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A4W5LYF9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGKPSSPQGGIEAVKAALRDSVDE
FELRYTRAFSDLCSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVMRIADWMATYLDN
HIQPWIQSQGGWDRFALIFGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A4W5LZB2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=194 residues).
MNNTHGVACTHTMKISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYM
DDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVEAVGEEISAYLVTHHKDWLVKHNSWNGFV
EFFSVAETESRSRNIIATLVGLAGIGAAMTLLAM
>gnl|bcl2dbpro|A0A4W5MLY7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Hucho hucho GN=BCL2L10 (length=196 residues).
MSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPPPSDSAAAMRCQARDMEAKHRARFHALAHSFLCQCGPNPCASLRR
VMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQALGNGMGLGGKESCRALAETIADYLGEEKSDWMLENKGWEGFC
KFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A4W5NQ40_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=232 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHIELTEAQNRTEGGQVEGGAAVMTYVNGTVNGTSPGTPPPQQSPPSSPRRTAGL
DAVKEALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMNPLV
GRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A4W5NW18_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho GN=BCL-2 (length=228 residues).
MMANENPYDSRFIVEKYIHHKLLKMGFVWKFQAENDYPNNGFGDPSAPNTREVFARRSQPTAAGEDTDSPYQNRSPQPDP
HARLNRVLREAGDEIGRIYHPDFAEMSGQLHFTPNTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A4W5Q5Q2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=262 residues).
METAKRKTLLSLFDGTGSICKPFVEAGWTVRRLDIDSRHGADIVVDIRKWDPLDSVSARARMNNTHGVACVYKCQRCKGI
LSSCELETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVST
LAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAEPESRS
RNIIATLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A4W5Q5Q2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=201 residues).
ADKVTVNRARAGDNGNSQAENISHQETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNG
MINTLYMYDRGDDVRFVSTLAHIIFRDGTVNWGRVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKH
NSWNGFVEFFSVAEPESRSRNIIATLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A4W5QGT1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho GN=MCL-1 (length=283 residues).
MSLSKSIARATTTMLHFQNGGSSYLANDASPLCYFNGAGASPTSKVDLGNGTGDTPPRPTTLGVSVVKSNVLDNHLSDRS
NNDDSDDSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIEHFLRDYTGLSQPRWKQSKPLTTMKRVVEDVIAKHRYAF
NGMIAKLDLDDRCDDMRVINSVAKTMFGDRVTNWGRIASLVAFGAVVSQHLKENGRGHCVDLVGQEIATYLLSDQRDWLV
KNNAWNGFVEFFHVQDPESSVRNTLLAFAGVAGIGATLAMLIR
>gnl|bcl2dbpro|A0A4W5R2W6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=234 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTM
GLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSP
LVGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
>gnl|bcl2dbpro|A0A4W5R2W6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Hucho hucho GN=BCL2L1 (length=233 residues).
MCINLPELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGERGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSSPQRTMG
LDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPL
VGRIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMTLVTGVILGSLIAQKRL
© 1998-2020Legal notice