Dataset for protein BCL-2-like of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5QGT1_MCL1-01      MSLSKSIARATTTMLHFQNG--GSSYLANDASPLCYFNGA----GASPTS
A0A4W5LP06_MCL1-01      --MSLSVTRATTTMWHYQNGVFGPSYSAG-ASPLCYFATGAVCPGASPKS
A0A4W5LP06_MCL1-02      --MSLSVTRATTTMWHYQNGVFGPSYSAG-ASPLCYFATGAVCPGASPKS
A0A4W5LZB2_MCL1-01      --------------------------------------------------
A0A4W5KYB3_MCL1-01      ------------------MYHVPHTVDK---HKCWTC-KLEIDSFVENDT
A0A4W5Q5Q2_MCL1-02      -------METAKRKTLLSLFDGTGSICKPFVEAGWTVRRLDIDSRHGADI
A0A4W5NQ40_BCL2L1-      --------------------------------------------------
A0A4W5R2W6_BCL2L1-      --------------------------------------------------
A0A4W5R2W6_BCL2L1-      --------------------------------------------------
A0A4W5JPK5_BCL2L1-      --------------------------------------------------
A0A4W5LYF9_BCL2L1-      --------------------------------------------------
A0A4W5KV00_BCL2-01      --------------------------------------------------
A0A4W5NW18_BCL2-01      --------------------------------------------------
A0A4W5MLY7_BCL2L10      --------------------------------------------------
A0A4W5LF91_MCL1-01      --------------------------------------------------
A0A4W5Q5Q2_MCL1-01      --------------------------------------------------
                                                                          

A0A4W5QGT1_MCL1-01      KV--DLGNGTGDTPPRPTTLGVSVVKSNVLDNHLSDRSNNDDSDDSLPCT
A0A4W5LP06_MCL1-01      KVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNHLSDLSNNDDSGDSLPCT
A0A4W5LP06_MCL1-02      KVDTDLGNGTGDTPPRPTTLGVNGVKSNVLGNHLSDLSNNDDSGDSLPCT
A0A4W5LZB2_MCL1-01      ------------------MNNTHGVACTHTMKIS----------------
A0A4W5KYB3_MCL1-01      LLGEHIYHVYNT-----------GGHCRYLADRYTNREEEIMLILGKERY
A0A4W5Q5Q2_MCL1-02      VVDIRKWDPLDSVSARARMNNTHGVACVYKCQRC----------------
A0A4W5NQ40_BCL2L1-      ----------------MMTYNNRELVVYYITYKLSQRDYPFNHIELTEAQ
A0A4W5R2W6_BCL2L1-      ----------------IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAP
A0A4W5R2W6_BCL2L1-      -----------------MCINLPELVVYYITYKLSQRDYPFNHIGLTEAP
A0A4W5JPK5_BCL2L1-      -----------------MSYSNRELVVFFISYRLSQRNYSCCQLGLEGAS
A0A4W5LYF9_BCL2L1-      -----------------MSYSNRELVVFFISYKLSQRNYPCCQLVLEGAS
A0A4W5KV00_BCL2-01      -------------MAND---DNRFIVEKYICHKLLKRGYAWDFEDAEEEE
A0A4W5NW18_BCL2-01      ------------MMANENPYDSRFIVEKYIHHKLLKMGFVWKFQAENDYP
A0A4W5MLY7_BCL2L10      --------------------------------------------------
A0A4W5LF91_MCL1-01      ----------------MYHVPHTVDKHKCWTCKLEIDSFVENDTLLGEHI
A0A4W5Q5Q2_MCL1-01      -----------------------------------ADKVTVNRARAGDN-
                                                                          

A0A4W5QGT1_MCL1-01      PQMASECGPELSNCPSGDEVLEHDTRQLIEHF-LRDYTGLSQPR--WKQS
A0A4W5LP06_MCL1-01      PEMASECGPELSNCPSADEVLEHDTRQVIEDL-LGDYTGLSQPR--WKES
A0A4W5LP06_MCL1-02      PEMASECGPELSNCPSADEVLEHDTRQVIEDL-LGDYTGLSQPR--WKES
A0A4W5LZB2_MCL1-01      ---------HQETC----DALDTDTRQLMTCV-LGQYTGLLK--RGWNES
A0A4W5KYB3_MCL1-01      RKGTVAFPETMETC----DALDTDTRQLMTCV-LGQYTGLLK--RGWNES
A0A4W5Q5Q2_MCL1-02      -KGILSSCE-LETC----DALDTDTRQLIKCV-LGQYTGLLK--RGWNES
A0A4W5NQ40_BCL2L1-      NRTEG---GQVEGGAAVMTYVNGTVNGTSPGTPPPQQSPPSSPRRTAGLD
A0A4W5R2W6_BCL2L1-      SRTEGGERGQVEGGAAVTTHPNGTVNGTSPGT-PPRQSPPSSPQRTMGLD
A0A4W5R2W6_BCL2L1-      SRTEGGERGQVEGGAAVTTHPNGTVNGTSPGT-PPRQSPPSSPQRTMGLD
A0A4W5JPK5_BCL2L1-      GRTEGDE-----------AIANGSV-GNNRNS-RSNLAKPSSPQG--GME
A0A4W5LYF9_BCL2L1-      GRTEGDE-----------AIANGSL-GNNRNG-RSNLGKPSSPQG--GIE
A0A4W5KV00_BCL2-01      GAANNELMISPRPGLARRCHGANNAGPGSVPR-LSKWLSQPDPHA-----
A0A4W5NW18_BCL2-01      NNGFGDPSAPNTREVFARRSQPTAAGEDTDSP-YQNRSPQPDPHA-----
A0A4W5MLY7_BCL2L10      -----------MSCGLWKETLAIAEDYLSVCS-IIPASGSRKAPPGPPPS
A0A4W5LF91_MCL1-01      YHTHTMKISHQETC----DALDTDTRQLMTCV-LGQYTGLLK--RGWNES
A0A4W5Q5Q2_MCL1-01      GNSQAENISHQETC----DALDTDTRQLIKCV-LGQYTGLLK--RGWNES
                                                                 .        

A0A4W5QGT1_MCL1-01      KPLTTMKRVVEDVIAKHRYAFNGMIAKLDLDDRCDDMRVINSVAKTMFGD
A0A4W5LP06_MCL1-01      KALTTMKRVVKDVIAKHRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSD
A0A4W5LP06_MCL1-02      KALTTMKRVVKDVIAKHRYAYNGMIAKLDLDDRCDDMSFIKSVAKTLFSD
A0A4W5LZB2_MCL1-01      KALSTMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRD
A0A4W5KYB3_MCL1-01      KALSTMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRD
A0A4W5Q5Q2_MCL1-02      KALSTMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVSTLAHIIFRD
A0A4W5NQ40_BCL2L1-      AVKEALRDSANEFELRYARAFSDLSSQLHI-TPSTAYQSFENVMDEVFRD
A0A4W5R2W6_BCL2L1-      AVKEALRDSANEFELRYARAFSDLSSQLHI-TPATAYQSFENVMDEVFRD
A0A4W5R2W6_BCL2L1-      AVKEALRDSANEFELRYARAFSDLSSQLHI-TPATAYQSFENVMDEVFRD
A0A4W5JPK5_BCL2L1-      AVKAALRDSVDEFELRYTRAFSDLSSQLHI-TPATAYHSFESVMDEVFRD
A0A4W5LYF9_BCL2L1-      AVKAALRDSVDEFELRYTRAFSDLCSQLHI-TPATAYHSFESVMDEVFRD
A0A4W5KV00_BCL2-01      AIHRVLREAGDELERLYQPDFAEMSHQLYL-TSSTAERRFREVIDELFRD
A0A4W5NW18_BCL2-01      RLNRVLREAGDEIGRIYHPDFAEMSGQLHF-TPNTAQRRFTAVIDELFSD
A0A4W5MLY7_BCL2L10      DSAAAMRCQARDMEAKHRARFHALAHSFLCQCGPNPCASLRRVMEELVGD
A0A4W5LF91_MCL1-01      KALSTMSRVVGQLLEKHRYTYNGMINTLYMDDRGDDVRFVSTLAHIIFRD
A0A4W5Q5Q2_MCL1-01      KALSTMSRVVGQLLEKHRYTYNGMINTLYMYDRGDDVRFVSTLAHIIFRD
                            .:     :.   :   :  :   :           .  :   :. *

A0A4W5QGT1_MCL1-01      RVTNWGRIASLVAFGAVVSQHLKEN-------------GRGHCVDLVGQE
A0A4W5LP06_MCL1-01      GTTNWGRIASLVAFGAVVSQQLKER-------------SRGHCIGLVGQE
A0A4W5LP06_MCL1-02      GTTNWGRIASLVAFGAVVSQQLKER-------------SRGHCIGLVGQE
A0A4W5LZB2_MCL1-01      GTVNWGRVASLTSFGAAVCQYLKDE-------------GRDNCVEAVGEE
A0A4W5KYB3_MCL1-01      GTVNWGRVASLTSFGAAVCQYLKDE-------------GRDNCVEAVGEE
A0A4W5Q5Q2_MCL1-02      GTVNWGRVASLTSFGAAVCQYLKDE-------------GRDNCVELVGEE
A0A4W5NQ40_BCL2L1-      G-VNWGRVVGLFAFGGALCVECVDK-------------EMNPLVGRITDW
A0A4W5R2W6_BCL2L1-      G-VNWGRVVGLFAFGGALCVECVEK-------------EMSPLVGRIADW
A0A4W5R2W6_BCL2L1-      G-VNWGRVVGLFAFGGALCVECVEK-------------EMSPLVGRIADW
A0A4W5JPK5_BCL2L1-      G-VNWGRVVGLFAFGGALCVECVEK-------------DMSPLVARIADW
A0A4W5LYF9_BCL2L1-      G-VNWGRVVGLFAFGGALCVECVEK-------------DMSPLVMRIADW
A0A4W5KV00_BCL2-01      G-VNWGRIIAFFEFGGTICVECVNK-------------EMTSQVDHIAVW
A0A4W5NW18_BCL2-01      G-VNWGRIVAFFEFGGTMCVESVNR-------------EMTSQVDNIARW
A0A4W5MLY7_BCL2L10      GQMNWGRVVSLFTFTGVLVRELQGEDTDQALGNGMGLGGKESC-RALAET
A0A4W5LF91_MCL1-01      GTVNWGRVASLTSFGAAVCQYLKDE-------------GRDNCVEAVGEE
A0A4W5Q5Q2_MCL1-01      GTVNWGRVASLTSFGAAVCQYLKDE-------------GRDNCVELVGEE
                           ****: .:  * ..:                            :   

A0A4W5QGT1_MCL1-01      IATYLLSDQRDWLVKNNAWNGFVEFFHVQDPESSVRN-------TLLAFA
A0A4W5LP06_MCL1-01      IATYLLSDQRDWLVKNNAWNGFVDFFHVQDPESSVRN-------TLLAFA
A0A4W5LP06_MCL1-02      IATYLLSDQRDWLVKNNAWNGFVDFFHVQDPESSVRN-------TLLAFA
A0A4W5LZB2_MCL1-01      ISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRN-------IIATLV
A0A4W5KYB3_MCL1-01      ISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRN-------IIATLV
A0A4W5Q5Q2_MCL1-02      ISAYLVTHHKDWLVKHNSWNGFVEFFSVAEPESRSRN-------IIATLV
A0A4W5NQ40_BCL2L1-      MTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMT
A0A4W5R2W6_BCL2L1-      MTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMT
A0A4W5R2W6_BCL2L1-      MTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAENRKSQESFKKWLLAGMT
A0A4W5JPK5_BCL2L1-      MTTYLDNHIQPWIQSQGGWDRFAKIFGRDAAADVRRSQESIIKWLLVGVI
A0A4W5LYF9_BCL2L1-      MATYLDNHIQPWIQSQGGWDRFALIFGRDAAADVRRSQESLRKWLLVGVM
A0A4W5KV00_BCL2-01      MTEYLNGPLLNWIQENGGWEAFVELYDRQRDS-VFCSWPSIKTVFGLAAL
A0A4W5NW18_BCL2-01      MTEYLNGPLQNWIQENGGWDAFVEIYEQQR---ISHSWPYLKTVFGLAAL
A0A4W5MLY7_BCL2L10      IADYLGEEKSDWMLENKGWEGFCKFFHTAREVNQDSS-------MKTALF
A0A4W5LF91_MCL1-01      ISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRN-------IIATLV
A0A4W5Q5Q2_MCL1-01      ISAYLVTHHKDWLVKHNSWNGFVEFFSVAEPESRSRN-------IIATLV
                        :: **      *: .: .*: *  ::          .             

A0A4W5QGT1_MCL1-01      GVAGIGATLAMLIR------------------------------------
A0A4W5LP06_MCL1-01      GFAGIGATLAMLIRNSAD--------------------------------
A0A4W5LP06_MCL1-02      GFAGIGATLAMLIRSHHPSLLSSAVFELSPLIMNEERRLISSEAPLSDSF
A0A4W5LZB2_MCL1-01      GLAGIGAAMTLLAM------------------------------------
A0A4W5KYB3_MCL1-01      GLAGIGAAMTLLAM------------------------------------
A0A4W5Q5Q2_MCL1-02      GLAGIGAAMTLLVM------------------------------------
A0A4W5NQ40_BCL2L1-      LVTGVVVGSLFAQKRL----------------------------------
A0A4W5R2W6_BCL2L1-      LVTGVILGSLIAQKRL----------------------------------
A0A4W5R2W6_BCL2L1-      LVTGVILGSLIAQKRL----------------------------------
A0A4W5JPK5_BCL2L1-      LLSGVLVGTLIMKKRQ----------------------------------
A0A4W5LYF9_BCL2L1-      LLSGVLVGTLIMKKCQ----------------------------------
A0A4W5KV00_BCL2-01      GAASLTIGAYLTQK------------------------------------
A0A4W5NW18_BCL2-01      GAAGVTIGALFTQK------------------------------------
A0A4W5MLY7_BCL2L10      AAAGVGIAGLTFLLVR----------------------------------
A0A4W5LF91_MCL1-01      GLAGIG-AAMTLLAM-----------------------------------
A0A4W5Q5Q2_MCL1-01      GLAGIG-AAMTLLVM-----------------------------------
                          :.:                                             

A0A4W5QGT1_MCL1-01      -------------------------
A0A4W5LP06_MCL1-01      -------------------------
A0A4W5LP06_MCL1-02      PDGNAIYRSVLDSLFYKAKGLGCCR
A0A4W5LZB2_MCL1-01      -------------------------
A0A4W5KYB3_MCL1-01      -------------------------
A0A4W5Q5Q2_MCL1-02      -------------------------
A0A4W5NQ40_BCL2L1-      -------------------------
A0A4W5R2W6_BCL2L1-      -------------------------
A0A4W5R2W6_BCL2L1-      -------------------------
A0A4W5JPK5_BCL2L1-      -------------------------
A0A4W5LYF9_BCL2L1-      -------------------------
A0A4W5KV00_BCL2-01      -------------------------
A0A4W5NW18_BCL2-01      -------------------------
A0A4W5MLY7_BCL2L10      -------------------------
A0A4W5LF91_MCL1-01      -------------------------
A0A4W5Q5Q2_MCL1-01      -------------------------
                                                 

© 1998-2020Legal notice