Dataset for protein BCL-2-like of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------ynnrelvv
msmslsvtratttmwhyqngvfgpsysagdasplcyfawtavcpgaspkskvdtdlgngtgdtpprpttlmv-----n-l
  letakrktllslydvthti  s  l n dk fvhkntgvrrleidstvgn ivvdirkyhvyntmanrgtnsvksgg-
    k ia      l gpgs          c    eaggac k d   rhea  l  ehiw pldsvsamnsmgsth- e
              f f                    c          f                m   iarsdlpfi a
                                                                     e piv     h
                                                                     d c        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .: 
yyityklsqrdys-d-l-ltea--rteg-e----pegcdvldhdtrqvigcvlgq-ytglskpswpes-----kalstmr
cnhlsdr----dpf-s-p---epn-ec-p-ssqvestdaa-ttpngtlnetspntppsrqlprgsnqrtmgldavktals
-------lnnn--wnhigcep-mgs--tdslgnc-g-ae-teiaytsa-tdnrsd rpnwaqqrdkhg a mersnev k
kfyshriykmgfvgcqqvargysankgqgprishq-e--rrayvpnn mknlvrs lqqrgs pp ra   i dpha   
gv kmq ct rekctfnrenkqrsgnsnvmncetwravl mrsqala gsitdpr g kk      p       lar   
ft hc     a evkvei gdgqyagnillmppptp tf iceg    cphi ap                   i     
dr ca       aeim e  a e  af eafagnrk l            gf  g                         
             d   d    d     a    lm                                             
                 a                l                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :.   :   :  :   :              :   :. *   ****: .:  * ..:                   
rvvgelelkhryafngmisqLhitdrtddvsf-esvadevFrDG-vNWGRvvslfaFGgavcvelvek------------
dsadqfleryartysdlsntfymdpagayqrvvstlmhilvs rtt    iagfts tavlsqyckdedtdqalgngmgl
eagndvial tpd ae cak dlysscnqmasirn ikti g  vm     ia ve   tmvrqsqnr            
cq k mgri qar ha ahs lfqcnp pr  lkr  e m    q          t    i  h  gn            
   r i    h       g   c  g  eh   te                                             
   e                         c   na                                             
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :: **      *: .: .*: *  ::          .               :.:  .         
-grspcvglvgewittYLdnhiqdWlvknngWngFveffgvqapesssrs-------llaalvglaGvg-aaltmlkr--
gemdnlieriademaa  vtdhkp iqsqgs dr akiysrdeaaerrknqesfkkwiilgmtlvtsitvgtmilqimls
 skgsqrda-tqt sv  lspqrn mlehka ea cdhkart--vvs wpylrtvtgvtfaaas lli syaakv-qh
 d th  an  v   e  ngels             l  et d-vdnfh    ii  fkt vl f   il g ft avs 
   n   mh  r   d  ge kl                dq  esnqdc        m   am        lf lcr 
   e                                    m  d  i               i               n 
                                                              f                 
                                                                                
                                                                                

       330       340       350       360       370         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
-----------------------------------------------------------
hpsllssavfelsplimneerrlisseaplsdsfpdgnaiyrsvldslfykakglgccr
ad                                                         
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
© 1998-2023Legal notice