Dataset for protein BCL-2-like of organism Hucho hucho

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------tynnrgvvvyyi
msmslsvtratttmwhyqngvfgpsysagfasplcyfatlavdsgaspkskvdtdlgngtgdtpprpm-----elksnvl
  l k imetakrktllsmyhvtstvlkpdvhkgwtvrrgeicprvgndtvlgirkyhvyntvmanmtslgvn---ck--
       a      l f lfdgph id n  eac  cnkad   fheatil  ehiwdpldsms  iymnsthvia--fw
                       g  c           g                           erpvdstfghefht
                                                                  dnhipls d hvck
                                                                  a c  hp    t  
                                                                             r  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .            .:    
tyklsqrsyp-n-idl-ea-grtegee---letc----dalntdtrqlstcv-lgqytglskp-r-wneskalstmrrvv
-nr-------fds---t--t--mas--gpq-sngpavdevpdgtvngtipgtppsnqsppls-r-g-gldavktalsdsa
s-hyldldnnd-hlgslpcppng--dcrghv-g-asatthaehsa-yvmens rpdllkqpqaqgtmk--rsnev keag
gh-stkdnfvwcqglaegyssk-tvgsiseqt-evlwraivanalgpnnvdl yrrwgssrd ha p-qedpha   cq 
cqicenmgvtcmftvggdrynesqtspsetprs lfrmryqpinedegtrsr iqpra     pp app  lar      
mk   i kesvkrqren nqyqannmnpisnmr g gkctg      d kpp  ika           m  i        
hd   a e ei lee k hirh ilalmapm p      s         dhg                i           
dc       ae dda   ee a ha kc                       f                            
a            a         f  f                                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :.   :   :  :   :           .  :   :. *   ****: .:  * ..:                      
gelelkhryafngmisqLym-drgddyrffstvadevFrDG-vNWGRvaslfaFGgavcqelkek-------------gr
dqfleryartysdlsntfhidtpatavqsveslmhilvs rtt    ivgfts tavlsvycvdedtdqalgngmglgem
ndvial tpd ae cak dlycscnpmsrirn ikti g  vm     ia ve   tmvrqsqnr             sk
k mgri qar ha ahs lfq gs  qhvlkr  e m    q          t    i  h  gn             d 
r i    h       g   c   p  ea  te                                                
e                      n  c   na                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :   :: **      *: .: .*: *  ::          .               :.:               
dpcvgrvgeeittYLvthiqdWlvknngWngFveffsvaepesrsrs-------llaalvglaGigagalllqk------
snlieliadwmsa  dndhkp iqsqgs dr akiygrqaaaesrknqesfkkwiiltmtlvtsvtvastialrrlhpsl
gsq-daltqt av  lspqrn mlehka ea cdhkdrt--vvs wpylrtvtgvgfaaas llitmattimmqad  
th  rn  v   e  ngels             l  et d-vdnfh    ii  fkt vl f   i- lmmmkvvs    
n   mh  r   d  ge kl                dq  esnqdc        m   am     vl tyffalsr    
e   a                                m  d  i               i        g   vanh    
                                                           f              c     
                                                                                
                                                                                

       330       340       350       360       370     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
lssavfelsplimneerrlisseaplsdsfpdgnaiyrsvldslfykakglgccr
                                                       
                                                       
                                                       
                                                       
                                                       
                                                       
                                                       
© 1998-2020Legal notice