Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|D2IT42_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Gadus morhua GN=BCL2L10 (length=195 residues).
MSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELV
GDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGEEKRDWLLENGGWEGFCK
FSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|D2ITA0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=545 residues).
MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGRLVNKSQDDQE
GNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKHQYAYKGMIQK
LELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWN
AMLPAGYRQRDQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKGKAFVPTATGQIPLSEQITLEPELEEALK
NATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEV
NLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSLNIESNFITAEGMKAVVKAMASNA
TLVELKIDNQRHTLGDSVEMEIAAMLENNSSILKFGYHFTQQGPRARAAMAVTRNNDMLRQQRLR
>gnl|bcl2dbpro|D2ITA0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=277 residues).
MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGRLVNKSQDDQE
GNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKHQYAYKGMIQK
LELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWE
GFVEFFRVSDPETTVRNTLMAFAGFAGIGATIALLIR
>gnl|bcl2dbpro|D2ITA0_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=294 residues).
MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGRLVNKSQDDQE
GNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKHQYAYKGMIQK
LELDGRGEDMSFVTSVAKSLFADSTTNWGRIASLVAFGAALCQYLEARGKEGCVSLVAEEISSYLLSDQREWLVKNNSWE
GFVEFFRVSDPETTVRNTLMAFAGFAGIGATIALLIRSEGQVSREKNRNLPQQT
>gnl|bcl2dbpro|D2ITA0_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gadus morhua GN=MCL-1 (length=341 residues).
MSDPRDIDEDAILKGLSSAELEQLECELQDLDPENAMLPAGYRQRDQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIP
FTGEKKGRKAFVPTATGQIPLSEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTEGINSV
VKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFAC
AEMLQENTSLQSLNIESNFITAEGMKAVVKAMASNATLVELKIDNQRHTLGDSVEMEIAAMLENNSSILKFGYHFTQQGP
RARAAMAVTRNNDMLRQQRLR
>gnl|bcl2dbpro|D2ITA2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gadus morhua GN=BCL2L1 (length=227 residues).
MSIDTSMSISNRELVFFFLSHKLSQRNYRPIPFQPEGAGEGTDEDKSNRIGNNGLRLNDGNGNGQLAPSPTPQGTEAVRA
ALLESVEEFELRYTLAFSDLSSQLPITPATAYGSFESVMDEVFRDSINWGRIVGLFAFGGALCVECVEKEMSHMVPRVAE
WMTRYLDDHIDHWIQSNGGWKHFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLGALLAKKHV
© 1998-2022Legal notice