Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5CE84_MCL1-01      ------------------------------MLSQKLTSNYGTSLVQTCWF
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      MSDPRDIDEDAILKGLSSAELEQLECELQDLDPENAMLPAGYRQRDQTKK
A0A8C5CE84_MCL1-03      ------------------------------MLSQKLTSNYGTSLVQTCWF
A0A8C5CE84_MCL1-02      ------------------------------MLSQKLTSNYGTSLVQTCWF
A0A8C5CY11_BCL2L10      ----------------------------------MMASCLTCIKMAISSR
A0A8C5B4N8_BCL2L1-      ---------------------------------MSIDTSMSISNRELVFF
D2ITA2_BCL2L1-02        ---------------------------------MSIDTSMSISNRELVFF
A0A8C5C4C3_BCL2-01      ------------------------------MANV--------CNRDIVQK
A0A8C5FC81_BCL2L1-      ------------------------------MAQLDPARPLVSQNRELVLF
                                                                          

A0A8C5CE84_MCL1-01      NSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGR
D2IT42_BCL2L10-02       -MSCR--------LWKETLALSEDYLL-----------------------
A0A8C5CE84_MCL1-04      TPTGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKGRKAFVPTATGQIP
A0A8C5CE84_MCL1-03      NSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGR
A0A8C5CE84_MCL1-02      NSPQNGGEERNMDFHSEGSHTTTEGALPLMATFKSGDERKPRPTELGRGR
A0A8C5CY11_BCL2L10      NMSCR--------LWKETLALSEDYLL-----------------------
A0A8C5B4N8_BCL2L1-      FLSHK--------LSQRNY-----RPIPFQPEGADEGTDEDKSNRIGNNG
D2ITA2_BCL2L1-02        FLSHK--------LSQRNY-----RPIPFQPEGAGEGTDEDKSNRIGNNG
A0A8C5C4C3_BCL2-01      YIFHK--------LSKQGYMWEFEDAVEEEEVGNNRSIIAPPPTLVKRCR
A0A8C5FC81_BCL2L1-      YITHK--------LAQKNFPLNHLTLAATPPNRTEVGGAAPGPARVPAPH
                                       .                                  

A0A8C5CE84_MCL1-01      LVNKSQDDQEGNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRD
D2IT42_BCL2L10-02       ---------SCTASTGTAPPPPS---------------------------
A0A8C5CE84_MCL1-04      L--------SEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYY
A0A8C5CE84_MCL1-03      LVNKSQDDQEGNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRD
A0A8C5CE84_MCL1-02      LVNKSQDDQEGNGSLPSTPELQSEVDTDSQAGEEVLDNDTKRIIRIFLRD
A0A8C5CY11_BCL2L10      ---------SCTASTGTAPPPPS---------------------------
A0A8C5B4N8_BCL2L1-      L---RLNDGNGNGQLAPSPTPQG---------------------------
D2ITA2_BCL2L1-02        L---RLNDGNGNGQLAPSPTPQG---------------------------
A0A8C5C4C3_BCL2-01      G---EVGDDNDANTGPESIPRLS--------KR-----------------
A0A8C5FC81_BCL2L1-      A---N-GTPNGTTTAAAATPPPSPPPTAPPPRR-----------------
                                 .                                        

A0A8C5CE84_MCL1-01      YAGASKAKRTRQDEVQVTMRR--------------VVDGVLEKHQYAYKG
D2IT42_BCL2L10-02       -------------ESAAAMRG--------------LAQDMERQHYARFQA
A0A8C5CE84_MCL1-04      DALGCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSG
A0A8C5CE84_MCL1-03      YAGASKAKRTRQDEVQVTMRR--------------VVDGVLEKHQYAYKG
A0A8C5CE84_MCL1-02      YAGASKAKRTRQDEVQVTMRR--------------VVDGVLEKHQYAYKG
A0A8C5CY11_BCL2L10      -------------ESAAAMRG--------------LAQDMERQHYARFQA
A0A8C5B4N8_BCL2L1-      -----------TEAVRAALLE--------------SVEEFELRYTLAFSD
D2ITA2_BCL2L1-02        -----------TEAVRAALLE--------------SVEEFELRYTLAFSD
A0A8C5C4C3_BCL2-01      ---ITARHGDPRAATHRVLRE--------------AGDELERLYQADFTE
A0A8C5FC81_BCL2L1-      ---QSSAETVAMAAVKEALRD--------------TAGEFELRFTRAFSD
                                         .:                               

A0A8C5CE84_MCL1-01      MIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIAS-------------
D2IT42_BCL2L10-02       LAQSFLAQCEADACAGLRKVMEELVGDGQLNWGRVVS-------------
A0A8C5CE84_MCL1-04      LTEVNLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAE
A0A8C5CE84_MCL1-03      MIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIAS-------------
A0A8C5CE84_MCL1-02      MIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIAS-------------
A0A8C5CY11_BCL2L10      LAQSFLAQCEADACAGLRKVMEELVGDGQLNWGRVVS-------------
A0A8C5B4N8_BCL2L1-      LSSQ-LPITPATAYGSFESVMDEVFRDS-INWGRIVG-------------
D2ITA2_BCL2L1-02        LSSQ-LPITPATAYGSFESVMDEVFRDS-INWGRIVG-------------
A0A8C5C4C3_BCL2-01      MSHQ-LYLTSTTAQRRFREVIDELFRDG-VNWGRIIA-------------
A0A8C5FC81_BCL2L1-      LSSQ-LHITPATAYQSFESVMDEVFRDG-VNWGRVVG-------------
                        :               . .* . :  :.  :   : .             

A0A8C5CE84_MCL1-01      ----------------LVAFGAALCQYLEARGKEGCVSL-----------
D2IT42_BCL2L10-02       ----------------LFTFTGVLARQLQ---EKKGVQLGQDPGTGRALG
A0A8C5CE84_MCL1-04      MLQENTSLQSLNIESNFITAEGMKAVVKAMASNATLVEL-----------
A0A8C5CE84_MCL1-03      ----------------LVAFGAALCQYLEARGKEGCVSL-----------
A0A8C5CE84_MCL1-02      ----------------LVAFGAALCQYLEARGKEGCVSL-----------
A0A8C5CY11_BCL2L10      ----------------LFTFTGVLARQLQ---EKKGVQLGQDPGTGRALG
A0A8C5B4N8_BCL2L1-      ----------------LFAFGGALCVECV---EKEMSHM-----------
D2ITA2_BCL2L1-02        ----------------LFAFGGALCVECV---EKEMSHM-----------
A0A8C5C4C3_BCL2-01      ----------------FFEFGGTVCVECAGGQEEEMVAQ-----------
A0A8C5FC81_BCL2L1-      ----------------LFAFGGALCVECV---EKEMSSL-----------
                                        :.   .  .       :                 

A0A8C5CE84_MCL1-01      ---------VAEEISSYLLSDQREWLVKNNSWNAMLPAGYRQRDQTKKTP
D2IT42_BCL2L10-02       QVPGGSCRGLAETIADYLGEEKRDWLLENGGWE-----------------
A0A8C5CE84_MCL1-04      -----KIDNQRHTLGDSVEMEIAAMLENNSSIL-----------------
A0A8C5CE84_MCL1-03      ---------VAEEISSYLLSDQREWLVKNNSWE-----------------
A0A8C5CE84_MCL1-02      ---------VAEEISSYLLSDQREWLVKNNSWE-----------------
A0A8C5CY11_BCL2L10      QVPGGSCRGLAETIADYLGEEKRDWLLENGGWE-----------------
A0A8C5B4N8_BCL2L1-      ------VPRVAEWMTRYLDDHIDHWIQSNGGWK-----------------
D2ITA2_BCL2L1-02        ------VPRVAEWMTRYLDDHIDHWIQSNGGWK-----------------
A0A8C5C4C3_BCL2-01      ------VEHIAEWMTEYMNGHLNNWIQDNGGWE-----------------
A0A8C5FC81_BCL2L1-      ------VGRIAEWMTVYLDVHIQPWIQAQGGWE-----------------
                                     :   :       :  :..                   

A0A8C5CE84_MCL1-01      TGDYDRDALQDYLEKSALEHEDREDLIPFTGEKKGKAFVPTATGQIPLSE
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-01      QITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIAN
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-01      TEGINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKD
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-01      IPIPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSL
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-01      NIESNFITAEGMKAVVKAMASNATLVELKIDNQRHTLGDSVEMEIAAMLE
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-04      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-01      NNSSILKFGYHFTQQGPRARAAMAVTRNN---------------DMLRQQ
D2IT42_BCL2L10-02       ------GFCKF--SRIAREVNQESSMKTALFAAAGVGIAGLTF--LLVR-
A0A8C5CE84_MCL1-04      ------KFGYHFTQQGPRARAAMAVTRNN---------------DMLRQQ
A0A8C5CE84_MCL1-03      ------GFVEFF-----RVSDPETTVRNTLMAFAGFAGIGATIALLIRSE
A0A8C5CE84_MCL1-02      ------GFVEFF-----RVSDPETTVRNTLMAFAGFAGIGATIALLIR--
A0A8C5CY11_BCL2L10      ------GFCKF--SRIAREVNQESSMKTALFAAAGVGIAGLTF--LLVR-
A0A8C5B4N8_BCL2L1-      ------HFAAVFGSDAAAGARRTRDSHRRWMLVGAVLLTGVLLGALLAKK
D2ITA2_BCL2L1-02        ------HFAAVFGSDAAAGARRTRDSHRRWMLVGAALLTGVLLGALLAKK
A0A8C5C4C3_BCL2-01      ------SFVELYDRQRGSAFSCAWPSIRTVFGLAALGAASLTIGAYLTQK
A0A8C5FC81_BCL2L1-      ------RFSEVFGKDAAAESRRSQESFRKWFLAGMTLFTGVVVGSLFAQK
                               *                                      :   

A0A8C5CE84_MCL1-01      RLR------------
D2IT42_BCL2L10-02       ---------------
A0A8C5CE84_MCL1-04      RLR------------
A0A8C5CE84_MCL1-03      GQVSREKNRNLPQQT
A0A8C5CE84_MCL1-02      ---------------
A0A8C5CY11_BCL2L10      ---------------
A0A8C5B4N8_BCL2L1-      HV-------------
D2ITA2_BCL2L1-02        HV-------------
A0A8C5C4C3_BCL2-01      ---------------
A0A8C5FC81_BCL2L1-      RL-------------
                                       

© 1998-2023Legal notice