Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5CE84_MCL1-04      --------------------------------------------------
D2IT42_BCL2L10-02       ---------------------MSCR--------LWKETLALSEDYLL---
A0A8C5CE84_MCL1-01      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
A0A8C5CE84_MCL1-02      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
A0A8C5CE84_MCL1-03      MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALPLM
A0A8C5CY11_BCL2L10      ----MMASCLTCIKMAISSRNMSCR--------LWKETLALSEDYLL---
A0A8C5B4N8_BCL2L1-      ---MSIDTSMSISNRELVFFFLSHK--------LSQRNY-----RPIPFQ
D2ITA2_BCL2L1-02        ---MSIDTSMSISNRELVFFFLSHK--------LSQRNY-----RPIPFQ
A0A8C5C4C3_BCL2-01      MANV--------CNRDIVQKYIFHK--------LSKQGYMWEFEDAVEEE
A0A8C5FC81_BCL2L1-      MAQLDPARPLVSQNRELVLFYITHK--------LAQKNFPLNHLTLAATP
                                                                          

A0A8C5CE84_MCL1-04      --------------------------------------------------
D2IT42_BCL2L10-02       -----------------------------SCTASTGTAPPPPS-------
A0A8C5CE84_MCL1-01      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
A0A8C5CE84_MCL1-02      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
A0A8C5CE84_MCL1-03      ATFKSGDERKPRPTELGRGRLVNKSQDDQEGNGSLPSTPELQSEVDTDSQ
A0A8C5CY11_BCL2L10      -----------------------------SCTASTGTAPPPPS-------
A0A8C5B4N8_BCL2L1-      PEGADEGTDEDKSNRIGNNGL---RLNDGNGNGQLAPSPTPQG-------
D2ITA2_BCL2L1-02        PEGAGEGTDEDKSNRIGNNGL---RLNDGNGNGQLAPSPTPQG-------
A0A8C5C4C3_BCL2-01      EVGNNRSIIAPPPTLVKRCRG---EVGDDNDANTGPESIPRLS-------
A0A8C5FC81_BCL2L1-      PNRTEVGGAAPGPARVPAPHA---N-GTPNGTTTAAAATPPPSPPPTAPP
                                                                          

A0A8C5CE84_MCL1-04      --------------------------MSDPRDIDEDAILKGLSSAELEQL
D2IT42_BCL2L10-02       ---------------------------------ESAAAMRGLAQDMERQH
A0A8C5CE84_MCL1-01      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
A0A8C5CE84_MCL1-02      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
A0A8C5CE84_MCL1-03      AGEEVLDNDTKRIIRIFLRDYAGASKAKRTRQDEVQVTMRRVVDGVLEKH
A0A8C5CY11_BCL2L10      ---------------------------------ESAAAMRGLAQDMERQH
A0A8C5B4N8_BCL2L1-      -------------------------------TEAVRAALLESVEEFELRY
D2ITA2_BCL2L1-02        -------------------------------TEAVRAALLESVEEFELRY
A0A8C5C4C3_BCL2-01      -KR--------------------ITARHGDPRAATHRVLREAGDELERLY
A0A8C5FC81_BCL2L1-      PRR--------------------QSSAETVAMAAVKEALRDTAGEFELRF
                                                              :           

A0A8C5CE84_MCL1-04      ECELQDLDPENAMLPAGYRQRDQTKKTPTGDYDRDALQDYLEKSALEHED
D2IT42_BCL2L10-02       YARFQALA----------QSFLAQCEADACAGLRKVMEELVGDGQLNWGR
A0A8C5CE84_MCL1-01      QYAYKGMI----------QKLELDGRGEDMSFVTSVAKSLFADSTTNWGR
A0A8C5CE84_MCL1-02      QYAYKGMI----------QKLELDGRGEDMSFVTSVAKSLFADSTTNWGR
A0A8C5CE84_MCL1-03      QYAYKGMI----------QKLELDGRGEDMSFVTSVAKSLFADSTTNWGR
A0A8C5CY11_BCL2L10      YARFQALA----------QSFLAQCEADACAGLRKVMEELVGDGQLNWGR
A0A8C5B4N8_BCL2L1-      TLAFSDLS----------SQ-LPITPATAYGSFESVMDEVFRDS-INWGR
D2ITA2_BCL2L1-02        TLAFSDLS----------SQ-LPITPATAYGSFESVMDEVFRDS-INWGR
A0A8C5C4C3_BCL2-01      QADFTEMS----------HQ-LYLTSTTAQRRFREVIDELFRDG-VNWGR
A0A8C5FC81_BCL2L1-      TRAFSDLS----------SQ-LHITPATAYQSFESVMDEVFRDG-VNWGR
                              :            .              .. .. . ..  :.  

A0A8C5CE84_MCL1-04      REDLIPFTG-----------------------------------------
D2IT42_BCL2L10-02       VVSLFTFTGVLARQLQ---EKKGVQLGQDPGTGRALGQVPGGSCRGLAET
A0A8C5CE84_MCL1-01      IASLVAFGAALCQYLEARGKEGCVSL--------------------VAEE
A0A8C5CE84_MCL1-02      IASLVAFGAALCQYLEARGKEGCVSL--------------------VAEE
A0A8C5CE84_MCL1-03      IASLVAFGAALCQYLEARGKEGCVSL--------------------VAEE
A0A8C5CY11_BCL2L10      VVSLFTFTGVLARQLQ---EKKGVQLGQDPGTGRALGQVPGGSCRGLAET
A0A8C5B4N8_BCL2L1-      IVGLFAFGGALCVECV---EKEMSHM-----------------VPRVAEW
D2ITA2_BCL2L1-02        IVGLFAFGGALCVECV---EKEMSHM-----------------VPRVAEW
A0A8C5C4C3_BCL2-01      IIAFFEFGGTVCVECAGGQEEEMVAQ-----------------VEHIAEW
A0A8C5FC81_BCL2L1-      VVGLFAFGGALCVECV---EKEMSSL-----------------VGRIAEW
                           :. * .                                         

A0A8C5CE84_MCL1-04      --------------EKKGRKAFV---------------------------
D2IT42_BCL2L10-02       IADYLGEEKRDWLLENGGWEGFC---------------------------
A0A8C5CE84_MCL1-01      ISSYLLSDQREWLVKNNSWNAMLPAGYRQRDQTKKTPTGDYDRDALQDYL
A0A8C5CE84_MCL1-02      ISSYLLSDQREWLVKNNSWEGFV---------------------------
A0A8C5CE84_MCL1-03      ISSYLLSDQREWLVKNNSWEGFV---------------------------
A0A8C5CY11_BCL2L10      IADYLGEEKRDWLLENGGWEGFC---------------------------
A0A8C5B4N8_BCL2L1-      MTRYLDDHIDHWIQSNGGWKHFA---------------------------
D2ITA2_BCL2L1-02        MTRYLDDHIDHWIQSNGGWKHFA---------------------------
A0A8C5C4C3_BCL2-01      MTEYMNGHLNNWIQDNGGWESFV---------------------------
A0A8C5FC81_BCL2L1-      MTVYLDVHIQPWIQAQGGWERFS---------------------------
                                       : ..: :                            

A0A8C5CE84_MCL1-04      --------------------------PTATGQIPLSEQITLEPELEEALK
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-01      EKSALEHEDREDLIPFTGEKKGKAFVPTATGQIPLSEQITLEPELEEALK
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-04      NATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTEGINSVVKQDPF
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-01      NATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTEGINSVVKQDPF
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CE84_MCL1-03      --------------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-04      KIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKDIPIPTLKEVFEAM
D2IT42_BCL2L10-02       KF--SRIAREVNQESSMKTAL-----------------------------
A0A8C5CE84_MCL1-01      KIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKDIPIPTLKEVFEAM
A0A8C5CE84_MCL1-02      EFF-----RVSDPETTVRNTL-----------------------------
A0A8C5CE84_MCL1-03      EFF-----RVSDPETTVRNTL-----------------------------
A0A8C5CY11_BCL2L10      KF--SRIAREVNQESSMKTAL-----------------------------
A0A8C5B4N8_BCL2L1-      AVFGSDAAAGARRTRDSHRRW-----------------------------
D2ITA2_BCL2L1-02        AVFGSDAAAGARRTRDSHRRW-----------------------------
A0A8C5C4C3_BCL2-01      ELYDRQRGSAFSCAWPSIRTV-----------------------------
A0A8C5FC81_BCL2L1-      EVFGKDAAAESRRSQESFRKW-----------------------------
                         .                                                

A0A8C5CE84_MCL1-04      KGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSLNIESNFITAEGMK
D2IT42_BCL2L10-02       ---------------------FAAAGVGIAGLTF--LLVR----------
A0A8C5CE84_MCL1-01      KGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSLNIESNFITAEGMK
A0A8C5CE84_MCL1-02      ---------------------MAFAGFAGIGATIALLIR-----------
A0A8C5CE84_MCL1-03      ---------------------MAFAGFAGIGATIALLIRSEGQVSREKNR
A0A8C5CY11_BCL2L10      ---------------------FAAAGVGIAGLTF--LLVR----------
A0A8C5B4N8_BCL2L1-      ---------------------MLVGAVLLTGVLLGALLAKKHV-------
D2ITA2_BCL2L1-02        ---------------------MLVGAALLTGVLLGALLAKKHV-------
A0A8C5C4C3_BCL2-01      ---------------------FGLAALGAASLTIGAYLTQK---------
A0A8C5FC81_BCL2L1-      ---------------------FLAGMTLFTGVVVGSLFAQKRL-------
                                             :  .     .  .                

A0A8C5CE84_MCL1-04      AVVKAMASNATLVELKIDNQRHTLGDSVEMEIAAMLENNSSILKFGYHFT
D2IT42_BCL2L10-02       --------------------------------------------------
A0A8C5CE84_MCL1-01      AVVKAMASNATLVELKIDNQRHTLGDSVEMEIAAMLENNSSILKFGYHFT
A0A8C5CE84_MCL1-02      --------------------------------------------------
A0A8C5CE84_MCL1-03      NLPQQT--------------------------------------------
A0A8C5CY11_BCL2L10      --------------------------------------------------
A0A8C5B4N8_BCL2L1-      --------------------------------------------------
D2ITA2_BCL2L1-02        --------------------------------------------------
A0A8C5C4C3_BCL2-01      --------------------------------------------------
A0A8C5FC81_BCL2L1-      --------------------------------------------------
                                                                          

A0A8C5CE84_MCL1-04      QQGPRARAAMAVTRNNDMLRQQRLR
D2IT42_BCL2L10-02       -------------------------
A0A8C5CE84_MCL1-01      QQGPRARAAMAVTRNNDMLRQQRLR
A0A8C5CE84_MCL1-02      -------------------------
A0A8C5CE84_MCL1-03      -------------------------
A0A8C5CY11_BCL2L10      -------------------------
A0A8C5B4N8_BCL2L1-      -------------------------
D2ITA2_BCL2L1-02        -------------------------
A0A8C5C4C3_BCL2-01      -------------------------
A0A8C5FC81_BCL2L1-      -------------------------
                                                 

© 1998-2022Legal notice