Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D2ITA0_MCL1-01         MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--
D2ITA0_MCL1-04         -------------------MSDPRDIDEDAILKGLSSAELEQLECELQDL
D2ITA0_MCL1-02         MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--
D2ITA0_MCL1-03         MLSQKLTSNYGTSLVQTCWFNSPQNGGEERNMDFHSEGSHTTTEGALP--
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       --------------------------------------MSIDTSMSISNR
                                                                         

D2ITA0_MCL1-01         ------LMATFKSGDERKPRPTE----------LGRGRLVNKSQDD----
D2ITA0_MCL1-04         DPENAMLPAGYRQRDQTKKTPTGDYDRDALQDYLEKSALEHEDREDLIPF
D2ITA0_MCL1-02         ------LMATFKSGDERKPRPTE----------LGRGRLVNKSQDD----
D2ITA0_MCL1-03         ------LMATFKSGDERKPRPTE----------LGRGRLVNKSQDD----
D2IT42_BCL2L10-02      -------------------------------------------MSC----
D2ITA2_BCL2L1-02       ELVFFFLSHKLSQRNYRPIPFQP----------EGAGEGTDEDKSN----
                                                                   .     

D2ITA0_MCL1-01         -----------QEGNGSLPSTPE--LQSEVDTDSQAGEEVLDNDTKRIIR
D2ITA0_MCL1-04         TGEKKGRKAFVPTATGQIPLSEQITLEPELEEALKNATDAEMCDIAAILG
D2ITA0_MCL1-02         -----------QEGNGSLPSTPE--LQSEVDTDSQAGEEVLDNDTKRIIR
D2ITA0_MCL1-03         -----------QEGNGSLPSTPE--LQSEVDTDSQAGEEVLDNDTKRIIR
D2IT42_BCL2L10-02      -----------RLWKETLALSEDYLLSCTASTGTA---------------
D2ITA2_BCL2L1-02       -----------RIGNNGLRLNDG-----NGNGQLA---------------
                                     .  :  .         .                   

D2ITA0_MCL1-01         IFL----RDYAGA--SKAKRTRQDEVQVTMRR--------------VVDG
D2ITA0_MCL1-04         MYTLMSNKQYYDALGCTGKIANTEGINSVVKQDPFKIFPEEPPNTTNVEE
D2ITA0_MCL1-02         IFL----RDYAGA--SKAKRTRQDEVQVTMRR--------------VVDG
D2ITA0_MCL1-03         IFL----RDYAGA--SKAKRTRQDEVQVTMRR--------------VVDG
D2IT42_BCL2L10-02      ---------------PPPPSESAAAMRGL------------------AQD
D2ITA2_BCL2L1-02       ---------------PSPTPQGTEAVRAALLE--------------SVEE
                                                :.                    .: 

D2ITA0_MCL1-01         VLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASL-
D2ITA0_MCL1-04         TVERIHNNDSGLTEVNLNNIKDIPIPTLKEVFEAMKGNSYVEILSIAATR
D2ITA0_MCL1-02         VLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASL-
D2ITA0_MCL1-03         VLEKHQYAYKGMIQKLELDGRGEDMSFVTSVAKSLFADSTTNWGRIASL-
D2IT42_BCL2L10-02      MERQHYARFQALAQSFLAQCEADACAGLRKVMEELVGDGQLNWGRVVSL-
D2ITA2_BCL2L1-02       FELRYTLAFSDLSSQ-LPITPATAYGSFESVMDEVFRDS-INWGRIVGL-
                          .     . : .             . .* . :  :.  :   :..  

D2ITA0_MCL1-01         ----VAFGAA--------------LCQYLEARGKEGC-------------
D2ITA0_MCL1-04         SNDPVAFACAEMLQENTSLQSLNIESNFITAEGMKAV-------------
D2ITA0_MCL1-02         ----VAFGAA--------------LCQYLEARGKEGC-------------
D2ITA0_MCL1-03         ----VAFGAA--------------LCQYLEARGKEGC-------------
D2IT42_BCL2L10-02      ----FTFTGV--------------LARQLQEKKGVQLGQDPGTGRALGQV
D2ITA2_BCL2L1-02       ----FAFGGA--------------LCVECVEKEMSHM-------------
                           .:*  .               .                        

D2ITA0_MCL1-01         ----VSLVAEEISSYLLSDQREWLVKNNSWNAMLPAGYRQRDQTKKTPTG
D2ITA0_MCL1-04         ----VKAMASNATLVELKIDNQRHTLGDSVE-------------------
D2ITA0_MCL1-02         ----VSLVAEEISSYLLSDQREWLVKNNSWEGF-----------------
D2ITA0_MCL1-03         ----VSLVAEEISSYLLSDQREWLVKNNSWEGF-----------------
D2IT42_BCL2L10-02      PGGSCRGLAETIADYLGEEKRDWLLENGGWEGF-----------------
D2ITA2_BCL2L1-02       ----VPRVAEWMTRYLDDHIDHWIQSNGGWKHF-----------------
                              :*.  :    .    .   ... :                   

D2ITA0_MCL1-01         DYDRDALQDYLEKSALEHEDREDLIPFTGEKKGKAFVPTATGQIPLSEQI
D2ITA0_MCL1-04         --------------------------------------------------
D2ITA0_MCL1-02         --------------------------------------------------
D2ITA0_MCL1-03         --------------------------------------------------
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       --------------------------------------------------
                                                                         

D2ITA0_MCL1-01         TLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGCTGKIANTE
D2ITA0_MCL1-04         --------------------------------------------------
D2ITA0_MCL1-02         --------------------------------------------------
D2ITA0_MCL1-03         --------------------------------------------------
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       --------------------------------------------------
                                                                         

D2ITA0_MCL1-01         GINSVVKQDPFKIFPEEPPNTTNVEETVERIHNNDSGLTEVNLNNIKDIP
D2ITA0_MCL1-04         --------------------------------------------------
D2ITA0_MCL1-02         --------------------------------------------------
D2ITA0_MCL1-03         --------------------------------------------------
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       --------------------------------------------------
                                                                         

D2ITA0_MCL1-01         IPTLKEVFEAMKGNSYVEILSIAATRSNDPVAFACAEMLQENTSLQSLNI
D2ITA0_MCL1-04         --------------------------------------------------
D2ITA0_MCL1-02         --------------------------------------------------
D2ITA0_MCL1-03         --------------------------------------------------
D2IT42_BCL2L10-02      --------------------------------------------------
D2ITA2_BCL2L1-02       --------------------------------------------------
                                                                         

D2ITA0_MCL1-01         ESNFITAEGMKAVVKAMASNATLVELKIDNQRHTLGDSVEMEI-------
D2ITA0_MCL1-04         ----------------------------------------MEI-------
D2ITA0_MCL1-02         ----------------------------------------VEF-------
D2ITA0_MCL1-03         ----------------------------------------VEF-------
D2IT42_BCL2L10-02      ----------------------------------------CKF----SRI
D2ITA2_BCL2L1-02       ----------------------------------------AAVFGSDAAA
                                                                 .       

D2ITA0_MCL1-01         AAMLENNSSILKFGYHFTQQGPRARAAMAVTRNNDMLRQQRLR------
D2ITA0_MCL1-04         AAMLENNSSILKFGYHFTQQGPRARAAMAVTRNNDMLRQQRLR------
D2ITA0_MCL1-02         FRVSDPETTVRNTLMAFAGFAGIGATIALLIR-----------------
D2ITA0_MCL1-03         FRVSDPETTVRNTLMAFAGFAGIGATIALLIRSEGQVSREKNRNLPQQT
D2IT42_BCL2L10-02      AREVNQESSMKTALFAAAGVGIAGLTFLLVR------------------
D2ITA2_BCL2L1-02       GARRTRDSHRRWMLVGAALLTGVLLGALLAKKHV---------------
                             ::         :                               

© 1998-2022Legal notice