Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------fnspqnggeernmdfhsegshtttegalp--------lmatfksgderkprpte-------
mlsqkltsnygtslvqtcw-----------------------------nrepvnfm------qr---------dydrdal
                   msd rdid dailkgl samsiqlsmsisdldlefaf shkys--nytpktfqp       
                                      eled  ce q         p glr   q  ip  g       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .                   .  :  .         .                             
---lgrgrlvnksqdd---------------qegngslpstpe--lqsevdtdsqageevldndtkriirifl----rdy
qdy--------edrsnlipftgekkgrkafvrtwtntirlseqyt---tlsgqla------------------lmsn---
   eeksegth--mec               plakeq ndgil spngnegtknatdaemc iaa lgmyt    kq 
     a a ed  k                  i   g     d   ec ae a                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :.                    .:    .     . : .             . .* . :  :. 
aga--skakrtrqdevqvtmrr--------------vvdgvlekhqyaykgmiqkllldgrgedmsfvtsVakslfadst
---lgptptsqsteamrsv---dpfkifpeeppntt-aeeterryynrfsdltsv-epqtpatayptlrk meevvgng-
yd   csgppenaaginglvlq              s qdmvlqitlndqa sesn nnikdipigsfke fdamkr  y
      p  iag     aalke              n   f    ha     a qf aice d cag e          q

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :   :..      .:*  .               .                               :*.  :    .  
tnwgriasl-----vaFgaa--------------lcqyleargkegc-----------------vslvAeeissyllsdq
veilsvvgtrsndpft tgvemlqentslqslniesvqivekkmvqvgqdpgtgralgqvpggscrrm swmtrvegkik
l      a         ac                arfct eegshm                  pgl  taal  dehi
i                                   ne q    kal                  ka    d   ded

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .   ... :                                                                     
rewlvknnswegf-------------------------------------------------------------------
nqritsgggvn--lpagyrqrdqtkktptgdydrdalqdyleksalehedredlipftgekkgkafvptatgqiplseqi
dh hql d  khm                                                                   
 d  le     a                                                                    

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tlepeleealknatdaemcdiaailgmytlmsnkqyydalgctgkianteginsvvkqdpfkifpeeppnttnveetver
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ihnndsgltevnlnnikdipiptlkevfeamkgnsyveilsiaatrsndpvafacaemlqentslqslniesnfitaegm
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                .             ::         :                      
------------------------------vef-------arvsepessvrntlyafagqggrgrtamlvtr--------
kavvkamasnatlvelkidnqrhtlgdsvemkifgsdsrifamldnnttilkfgmhatqfapialailali-nndmlrqq
                              cav    aaag rvtrhrkwm vg  lvtivlagfa arksvgqvsre
                              a           ernq   m ta f    l  a       k he      

         
....:....
         
---------
rlrnlpqqt
kn       
         
© 1998-2022Legal notice