Dataset for protein BCL-2-like of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------s----snrqtvwfnsshk--------lssegy----egalp------------p-pt--gr-rl------d-n
mlsqklt-nygt-lvelc---mpqnggeernmdfhqrnshttt-yli-lmptgksggerk-r--rl--g--vnksqd-qe
 aqmsidtsmsiq-----fryl-cr        -wk-tlalsedrp-efqaefanedtdedksnevpnngg   rlntgs
  nvmparplvsikmdisskfit--         --q--pwnhl--vatpevrtgvsiia p alikapha   nvg p-
   ldm  c tcc  a  q  -f           a k fm ef t a ee n ner ga  g      c     e   d 
                  l                         d         d                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          :                 :   
gngslpstpppqs--------------------------------------qdevqaamrrvvdeveerhqyafsdls--
ctattats-elpgevdtdsqageevldndtkriiriflrdyagaskakrtr--asrvtllglaqgflrqytaryqgmipe
---q-gpatt---ppp appprr                    qtsrstvptedtarv kessedm lklylelka a  
dat-g---i-rl         k                     i amhgpara ekei  dtgsal  lferd te d  
  n a e                                        edd mi  h     a g e     c        
      a                                            d   d                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .              .. .. . ..  :.     :. * .                               
--------qq-llitratayssfrsVmdelfrDs-tNWGRivsLfaFggalcvelv---ekemvsl--------------
namlpagysklepdgpgedmgfvtkaaksvvakgtlehedvagfvt tav-aqyceargkegcsqmgqdpgtgralgqvp
        rsfdaqcetdtcagleledylg  qv    rid ip   -v-rq-qggq--kg-h-              
        h r ytks p qryd i  e  ai     ea  e   t  -- -     -- -q              
            ql k   gqr                                 a        a               
            h       d                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         : ..: :                                                
------vAEwitsYllshqreWlqknggWegFv-----------------------------------------------
ggsvrrl--emsr--dedidh-iveqnsrkhmcpagyrqrdqtkktptgdydrdalqdyleksalehedredlipftgek
   cpgi  t-ad mgdek-d -lskk  na a                                               
    gh-  - --  ----q-  -d     s s                                               
    e       v  nv lnp   a     r l                                               
            e   g   n                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
kgkafvptatgqiplseqitlepeleealknatdaemcdiaailgmytlmsnkqyydalgctgkianteginsvvkqdpf
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .                                                                     :  .     
kff-sdaaresnrettvrrtl--------------------------------------------------faaagvlqt
ev-g----avvrvtsssktrwnndsgltevnlnnikdipiptlkevfeamkgnsyveilsiaatrsndpvamlvgamgla
aiyperppnttdqsrdmhnih                                                   gf efaii
 l dreigsgaspaep e av                                                    c mt ge
    kqr  af c we i k                                                     l  l f 
              q  f                                                          a a 

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  .                                                                            
gvtlgsLlark---------------------------------------------------------------------
nlsi-aynvq-nvitaegmkavvkamasnatlvelkidnqrhtlgdsvemeiaamlennssilkfgyhftqqgpraraam
stlfq- irkshfvsr knrnlpqqt                                                      
 avval fieerq                                                                   
        t- gl                                                                   
         s                                                                      

       570     
....:....|....:
               
---------------
avtrnndmlrqqrlr
               
               
               
               
© 1998-2022Legal notice