Dataset for protein BCL-2-like of organism Erpetoichthys calabaricus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C4RFB4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=MCL-1 (length=295 residues).
MNPALATMNRSPATSLVQMLYCSGPSGLNGVFKHDALHLAKGADFTGSTQMMSVQLDEGELDDCLDEVDSVSQLHKSSSK
NCLKNLLFSAESSNADGSLPASPETPSSPMDSSQPGFTPAADAQLAQETEELIAAYLFRSAGLPCSRIRNGNKSFDTLVR
VGDSVIEKHKFAFNGMLRKLNISQEGDMGFMTPVAESIFSDGVINWGRVVSLVAFGAVVAKHLKQVNLERCIRPLADQIS
TFLLTRQKDWIVNNRAWEGFVEFFRIEDPEAGIRQALITFAGMAGIGAGIAYLIR
>gnl|bcl2dbpro|A0A8C4STP1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BCL2L1 (length=224 residues).
MPYSNKELVEDFISYKLSQKNFSCNQYFGDSRTATPGTSTPENEQDVLHVNGSVSGTENGGSSSADHSPDGIRAVKEALH
DSGDEFELRYRAAFSDLSSQLHITPVTAYQSFEQVINELFRDGVNWGRIVALFAFGGALCVECVEKEMGSLVKRIAEWMT
TYLDNNLDPWIQRQGGWDTFAKIYGSNAAAECRRSQERFSRWLLAGMTLATGLMLGSYFFHKRL
>gnl|bcl2dbpro|A0A8C4XBF6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BCL2L1 (length=198 residues).
MSYSNRELVEDFISYKLSQKNVLNSQSELDVLQVNGTGIINSFPATPASNGVKAVKEALRGSGDEFELRYRAAFNDLASQ
LHITPVTAYQSFEEVVGELFRDGVNWGRIVALFSFGGALCVECVEKEMVPLVRHIADWMTTYLDNNIDAWILSNGGWDTF
VRIYGRHASAEYFKKWLVVGVTMTAGLVLASFIAHTHL
© 1998-2022Legal notice