Dataset for protein BCL-2-like of organism Erpetoichthys calabaricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
    :.  *.. . .::.                                                        :* *.*
mnpalptm kspatslvqmlycsgpsglngvfkhdalhlakgadftgstqmmsvqldegelddcldevdsvsqlh s s 

        90       100       110       120       130       140       150       160
*   .                  *     ::    *     .      .: : *.                    ::*  
 fsksly-sdsstntp-tstpsp qpsspmds-vs fgnggdfqldpeseelk aylfrsaglpcsrirngnksfdt rg
 c c  l gaersaad slpaen l   h  g qp  eiaa ap ahapd ii                         hd

       170       180       190       200       210       220       230       240
 **..  .:. **..:  :*:*:       :  *  .:* *** ****:*:*.:**..:.    : ::   :. :*:.::
v  sviekhkf  sgmlrk n sqegdmgfmtp igsi s   i    v s vs  avvakhlkqvnlgrcikpl eqis
                              e ae                                ep   h      

       250       260       270       280       290       300     
*:* .. . **  : .*: *. ::    . *        *    :.*:    . ::         
 f ltrlkd  qrqra eg akffrirhpe gi-rsqit kk--mv mglgiaymig-yif-tr-
      i a  ln        e    ed a  c qaler ag  l  i aaa  a ffa kh 
© 1998-2023Legal notice