Dataset for protein BCL-2-like of organism Erpetoichthys calabaricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4RFB4_MCL1-01      MNPALATMNRSPATSLVQMLYCSGPSGLNGVFKHDALHLAKGADFTGSTQ
A0A8C4STP1_BCL2L1-      ----MPYSNKELVEDFIS--------------------------------
A0A8C4XBF6_BCL2L1-      ----MSYSNRELVEDFIS--------------------------------
                            :.  *.. . .::.                                

A0A8C4RFB4_MCL1-01      MMSVQLDEGELDDCLDEVDSVSQLHKSSSKNCLKNLLFSAESSNADGSLP
A0A8C4STP1_BCL2L1-      ------------------------YKLSQKNFSCNQYFGDSRTATPGTST
A0A8C4XBF6_BCL2L1-      ------------------------YKLSQKNVLNSQ--------------
                                                :* *.**   .               

A0A8C4RFB4_MCL1-01      ASPETPSSPMDSSQPGFTPAADAQLAQETEELIAAYLFRSAGLPCSRIRN
A0A8C4STP1_BCL2L1-      PENEQDVLHVNGSVSGTENGGSSSADHSPDGIRAVK--------------
A0A8C4XBF6_BCL2L1-      --SELDVLQVN----GTGIINSFPATPASNGVKAVK--------------
                           *     ::    *     .      .: : *.               

A0A8C4RFB4_MCL1-01      GNKSFDTLVRVGDSVIEKHKFAFNGMLRKLNISQEGDMGFMTPVAESIFS
A0A8C4STP1_BCL2L1-      -----EALHDSGDEFELRYRAAFSDLSSQLHITPVTAYQSFEQVINELFR
A0A8C4XBF6_BCL2L1-      -----EALRGSGDEFELRYRAAFNDLASQLHITPVTAYQSFEEVVGELFR
                             ::*   **..  .:. **..:  :*:*:       :  *  .:* 

A0A8C4RFB4_MCL1-01      DGVINWGRVVSLVAFGAVVAKHLKQVNLERCIRPLADQISTFLLTRQKDW
A0A8C4STP1_BCL2L1-      DGV-NWGRIVALFAFGGALCVECVEKEMGSLVKRIAEWMTTYLDNNLDPW
A0A8C4XBF6_BCL2L1-      DGV-NWGRIVALFSFGGALCVECVEKEMVPLVRHIADWMTTYLDNNIDAW
                        *** ****:*:*.:**..:.    : ::   :. :*:.::*:* .. . *

A0A8C4RFB4_MCL1-01      IVNNRAWEGFVEFFRIEDPEAGIRQALITFAG--MAGIGAGIAYLIR---
A0A8C4STP1_BCL2L1-      IQRQGGWDTFAKIYG-SNAAAECRRSQERFSRWLLAGMTLATGLMLGSYF
A0A8C4XBF6_BCL2L1-      ILSNGGWDTFVRIYG-RHASAEY------FKKWLVVGVTMTAGLVLASFI
                        *  : .*: *. ::    . *        *    :.*:    . ::    

A0A8C4RFB4_MCL1-01      -----
A0A8C4STP1_BCL2L1-      FHKRL
A0A8C4XBF6_BCL2L1-      AHTHL
                             

© 1998-2022Legal notice