Dataset for protein BCL-2-like of organism Cyclopterus lumpus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8C2X310_BCL2-06 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYVFGFDDVRDEDAADDGLIVVPPPTLVRRCRESGTGPDIESVPHLCKRLPQSDPTAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCAECAAKQEMTSQVDN
IAEWMTEYLNGPLNNWIQDNGGWDAFVELYDRQRDSLFNCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A8C2X310_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=184 residues).
MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEVNCLNNSVLTYWSGFFSVAQAQEKLGPVDMLVNCAGVSISGKFDEMEVDRFKIVTMGLFRTIALFYL
GSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A8C2X310_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKELEKFA
INDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A8C2X310_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=357 residues).
MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEAKLLQAKKELEKFAINDKQVYCLNNSVLTYWSGFFSVAQAQEKLGPVDMLVNCAGVSISGKFDEMEV
DRFKKLMEVNYLGSVYPTRAVITTMKERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAY
PPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIV
TMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A8C2X310_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=359 residues).
MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEAKLLQAKKELEKFAINDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAGVSISGKFDEM
EVDRFKKLMEVNYLGSVYPTRAVITTMKERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQ
IVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A8C2X310_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL-2 (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKELEKFA
INDKQVVLCISVDVSSEYSQVESVIKQAQEKLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSLFNCSWPSIKTVFG
LAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A8C2Z1X1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=MCL-1 (length=278 residues).
MNIISTKRAAFKMTGVMGCIILPQNGVVERPVHYGSGESSPLVAMGSAKDSHNGNAASNDAPKRPKILGYASKMIQGADD
HDGGSLPCTPEPDSEIDVSDSQAGAEVLENDTRQLMGRFLGDFTGLSKSQWHESRELSTMKRVVKDVLEKHRYAYNGMIN
KLSLDDRSDDASFVREVAKSLFADGTTNWGRIVSLVAFGAVVCQYLKEKNRGNCVELVGQEISTYLLSDQRDWLVKNNAW
EGFVEFFRVVDPESTVRNTLMAVAGFASIGATLALLIR
>gnl|bcl2dbpro|A0A8C2ZH46_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL2L1 (length=225 residues).
MSNINRELVEFFISYKLSQKNYPTSLLWPEEDAAGGRTEGDEADPASSNGSLVNGGDGDGAGPSGTSSPPSGDVEAVKAA
LRDSANEFELLFTQAFSDLSSQLDVTPVTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGSVLCVDCVEKDMSELVSRIADW
MTTYLDEHISAWIQSQGGWDCFAEIFGRDSAAEARISQETLRRWLLVGAALLKGVLGGMAISKKR
>gnl|bcl2dbpro|A0A8C2ZZ68_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL2L1 (length=234 residues).
MSQNRELVVFYINYKLSQRNYPLTHMGLTEPLNRTDGGEAGAGDAEEQRVATHANGTFNGTSPGTPPASPLRPQRLPSTT
NLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNHIQPWIQTQGGWERFAEIFGQDAAAESRKSQESFKKWLLAGVTLVTGVVVVLLIGQKRL
>gnl|bcl2dbpro|A0A8C3G7A6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL2L10 (length=192 residues).
MSCGLWKETLALAEDYLYLCCTSPRPAPPPPSESATAMRRLAQDMETQHQARFHSLAQTFLRQCGPDPCSSLRKVIEELV
GDGHLNWGRVVSLFTFTGVLARQLLEQNGTKLGLDPGQELEQESGNCRGLAETIADYLGEEKKDWLLENDGWEGFCKFSR
SAREVGQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2022Legal notice