Dataset for protein BCL-2-like of organism Cyclopterus lumpus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2Z1X1_MCL1-01      ----------------------------MNIISTKRAAFKMTGVM-----
A0A8C2X310_BCL2-03      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYM-----
A0A8C2X310_BCL2-02      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYM-----
A0A8C2X310_BCL2-04      ---------------------------MLLVVAAFIVAFVLLLYM-----
A0A8C2X310_BCL2-01      ---------------------------MLLVVAAFIVAFVLLLYM-----
A0A8C2X310_BCL2-06      MANE---------------------------CNRNIVEKYICHKLSKRGY
A0A8C2ZH46_BCL2L1-      -MSN---------------------------INRELVEFFISYKLSQKNY
A0A8C2ZZ68_BCL2L1-      --MS---------------------------QNRELVVFYINYKLSQRNY
A0A8C2X310_BCL2-05      MSSEEGLSSTITDWLLINSWWLLLPFVMLLVVAAFIVAFVLLLYM-----
A0A8C3G7A6_BCL2L10      MSCG------------------------LWKETLALAEDYLYLCC-----
                                                            .   :         

A0A8C2Z1X1_MCL1-01      -----------------------------------------GCIILPQN-
A0A8C2X310_BCL2-03      -----------------------------------------ISPLISPK-
A0A8C2X310_BCL2-02      -----------------------------------------ISPLISPK-
A0A8C2X310_BCL2-04      -----------------------------------------ISPLISPK-
A0A8C2X310_BCL2-01      -----------------------------------------ISPLISPK-
A0A8C2X310_BCL2-06      VFGFD--------DVRDEDAADDGLIVVPPPTLVRRCRESGTGPDIESV-
A0A8C2ZH46_BCL2L1-      PTSLLWPEEDAAGGRTEGDEADPASSNGSLV---NGGDGDGAGPSGTSS-
A0A8C2ZZ68_BCL2L1-      PLTHMGLTEPL--NRTDGGEAGAGDAEEQRVATHANGTFNGTSPGTPPAS
A0A8C2X310_BCL2-05      -----------------------------------------ISPLISPK-
A0A8C3G7A6_BCL2L10      -----------------------------------------TSPRPAPP-
                                                                          

A0A8C2Z1X1_MCL1-01      -------GVVERPVHY----------------------------------
A0A8C2X310_BCL2-03      -------PLKLNGAHV----------------------------------
A0A8C2X310_BCL2-02      -------PLKLNGAHV----------------------------------
A0A8C2X310_BCL2-04      -------PLKLNGAHV----------------------------------
A0A8C2X310_BCL2-01      -------PLKLNGAHV----------------------------------
A0A8C2X310_BCL2-06      PHLCKRLPQSDPTAAIHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQ
A0A8C2ZH46_BCL2L1-      -------PPSGDVEAVKAALRDSANEFELLFTQAFSDLSSQLDVTPVTAY
A0A8C2ZZ68_BCL2L1-      PLRPQRLPSTTNLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAY
A0A8C2X310_BCL2-05      -------PLKLNGAHV----------------------------------
A0A8C3G7A6_BCL2L10      -------PPSESATAMRRLAQDMETQHQARFHSLAQTFLRQCGPDPCS--
                                                                          

A0A8C2Z1X1_MCL1-01      ---------GSGESSPLVAMGSAKDSHNGNAASNDAPKRPKILGYAS---
A0A8C2X310_BCL2-03      ---------VVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK---
A0A8C2X310_BCL2-02      ---------VVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK---
A0A8C2X310_BCL2-04      ---------VVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK---
A0A8C2X310_BCL2-01      ---------VVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAK---
A0A8C2X310_BCL2-06      RRFAEVIDELFRDG-VNWGRIIAFFEFGGTVCAECAAKQEMTSQVDN---
A0A8C2ZH46_BCL2L1-      HSFKSVMDEVFKDG-VNWGRVVGLFAFGSVLCVDCVEK-DMSELVSR---
A0A8C2ZZ68_BCL2L1-      QSFENVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEK-EMSPLVGR---
A0A8C2X310_BCL2-05      ---------VVTGGSSGIGKCIAIECY----------RQGAFITL-----
A0A8C3G7A6_BCL2L10      -SLRKVIEELVGDGHLNWGRVVSLFTFTGVLARQLLEQNGTKLGLDPGQE
                                     .    .   .   .          .            

A0A8C2Z1X1_MCL1-01      ---KMIQGADDHDGGSLPCTPEPDSEIDVSDSQAGAEVL-----ENDTRQ
A0A8C2X310_BCL2-03      ---KELEKFAINDKQ-VYCL-----NNSVLTYWSGFFSV------AQAQE
A0A8C2X310_BCL2-02      ---KELEKFAINDKQVVLCI-----SVDVSSEYSQVESV-----IKQAQE
A0A8C2X310_BCL2-04      ---KELEKFAINDKQVVLCI-----SVDVSSEYSQVESV-----IKQAQE
A0A8C2X310_BCL2-01      ---KELEKFAINDKQVVLCI-----SVDVSSEYSQVESV-----IKQAQE
A0A8C2X310_BCL2-06      ----------IAEWMTEYLNGPLNNWIQDNGGWDAFVELYDRQRDSLFNC
A0A8C2ZH46_BCL2L1-      ----------IADWMTTYLDEHISAWIQSQGGWDCFAEIFGRDSAAEARI
A0A8C2ZZ68_BCL2L1-      ----------IIEWMTVYLDNHIQPWIQTQGGWERFAEIFGQDAAAESRK
A0A8C2X310_BCL2-05      VARDEVNC--LNNSVLTY--------------WSGFFSV--AQAQEKLGP
A0A8C3G7A6_BCL2L10      LEQESGNCRGLAETIADYLGEEKKDWLLENDGWEGFCKF--SRSAREVGQ
                                    :                         .           

A0A8C2Z1X1_MCL1-01      LMG-----------RFLGDFTGLSKSQWHESRELSTM------KRVVKDV
A0A8C2X310_BCL2-03      KLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
A0A8C2X310_BCL2-02      KLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
A0A8C2X310_BCL2-04      KLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
A0A8C2X310_BCL2-01      KLGPVDMLVNCAGVSISGKFDEMEVDRFKKLMEVNYLGSVYPTRAVITTM
A0A8C2X310_BCL2-06      SWPSIKTVFGLAALGAAS------------LTIGAYL-------------
A0A8C2ZH46_BCL2L1-      SQETLRRWLLVGAALLKG------------VLGGMAI-------------
A0A8C2ZZ68_BCL2L1-      SQESFKKWLLAGVTLVTG------------VVVVLLI-------------
A0A8C2X310_BCL2-05      ----VDMLVNCAGVSISGKFDEMEVDRFKIVTMGLFR-------------
A0A8C3G7A6_BCL2L10      DSSMKTALFAAAGVGLAG------------LTFLLVR-------------
                                         .                                

A0A8C2Z1X1_MCL1-01      LEKHR------YAYNGMINKLSLDDRSDDASFVREVAKSLFADGTTNWGR
A0A8C2X310_BCL2-03      KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQME-IKPYNI
A0A8C2X310_BCL2-02      KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQME-IKPYNI
A0A8C2X310_BCL2-04      KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQME-IKPYNI
A0A8C2X310_BCL2-01      KERRRGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQME-IKPYNI
A0A8C2X310_BCL2-06      --------------------------------------------------
A0A8C2ZH46_BCL2L1-      --------------------------------------------------
A0A8C2ZZ68_BCL2L1-      --------------------------------------------------
A0A8C2X310_BCL2-05      --------------------------------------------------
A0A8C3G7A6_BCL2L10      --------------------------------------------------
                                                                          

A0A8C2Z1X1_MCL1-01      IVSLVAFGAVVCQYLKEKNRGNCVEL-VGQEISTYLLSDQRDWLVKNNAW
A0A8C2X310_BCL2-03      YVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAV
A0A8C2X310_BCL2-02      YVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAV
A0A8C2X310_BCL2-04      YVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAI
A0A8C2X310_BCL2-01      YVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAV
A0A8C2X310_BCL2-06      --------------------------------------------------
A0A8C2ZH46_BCL2L1-      --------------------------------------------------
A0A8C2ZZ68_BCL2L1-      --------------------------------------------------
A0A8C2X310_BCL2-05      --------------------------------------------------
A0A8C3G7A6_BCL2L10      --------------------------------------------------
                                                                          

A0A8C2Z1X1_MCL1-01      EGFVEFFRVVDPESTVRNTLMA----------------------------
A0A8C2X310_BCL2-03      QG--NFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR------
A0A8C2X310_BCL2-02      QG--NFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR------
A0A8C2X310_BCL2-04      -----------------------------VTMGLFR--------------
A0A8C2X310_BCL2-01      QG--NFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSL
A0A8C2X310_BCL2-06      --------------------------------------------------
A0A8C2ZH46_BCL2L1-      --------------------------------------------------
A0A8C2ZZ68_BCL2L1-      --------------------------------------------------
A0A8C2X310_BCL2-05      --------------------------------------------------
A0A8C3G7A6_BCL2L10      --------------------------------------------------
                                                                          

A0A8C2Z1X1_MCL1-01      ----------VAGFASIGATLALLIR---------------
A0A8C2X310_BCL2-03      ----------TIALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-02      ----------TIALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-04      ----------TIALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C2X310_BCL2-01      FNCSWPSIKTVFGLAALGAASLTIGAYLTQK----------
A0A8C2X310_BCL2-06      ------------------------------------TQK--
A0A8C2ZH46_BCL2L1-      ------------------------------------SKKR-
A0A8C2ZZ68_BCL2L1-      ------------------------------------GQKRL
A0A8C2X310_BCL2-05      ----------TIALFYLGSFDSIVRRCMIQREQSKAADKRE
A0A8C3G7A6_BCL2L10      -----------------------------------------
                                                                 

© 1998-2022Legal notice