Dataset for protein BCL-2-like of organism Cyclopterus lumpus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    .   :                                       
--se------------------------llvvaafivafvlllym-----------------------------------
ms--eglsstitdwllinswwlllpfvm---inrelaekyiyyklsqrnypttlmwpteplagnrtdgdeadpgssvvsr
 mns                        mwkqttnr vdkmthvc kkg vlshlgle da  gvreega gdalingqp
 amn                         nieslk    f sgc       fgfd        d        a daeepl
  cg                           c  a      n                                      
                                         c                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------isPlispk--------Plklngahv-------------------------------------------v
vttvrrgtgsgtgistpsvsplrpqrlgpsesvvaykralrdsanefelrytsafsdlsrqlyvtpvtayrsfrsvmdel
palhnncrfn gc rptqs  hlck   vvtrtt mrevaqemgtqlqrlfqrlattmls chpdsts qqrlkn ie g
    ag ded a  ile p         stgppe ihal   aed h a  hqd qefhn  gl  c   h  ek     
              gga n         q ddld                 ap         di  a      ae     
              d   a             a                                               
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .    .   .   .          .                        :                         . 
vtgGssgiGkciaiecyrqgafitlvardeakllqak------kelek--indkqvvyci-----widvssgwsgfesv-
frds-vnwarvvglfafggvlcvecaek-gmssgvdrgqever-----falaewmttlldehisssvq-qgeyeqvfelf
sge hplv misskdth----a-----qqpttptl--   laqesvncrgdintv-lp--pepqp---tnd-qdraaviy
 k   l    g  f s tstv-sqdlp rdkiiqyss      dmiqgad h sise  tnplnnnnss--y ac vkf 
               e n n  rn    n  fe  gp        g       ggld  ng kkdellelts  a c   
                   a  ad            n                  a   l   da   d           
                                                           g                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
----ikqaqeklgpvdmlvncagvsisGkfdemevdrfk-lmevnyl---------------------------------
grqsaaevrqsqe--k-wllaga-llas-----------kvtvglvrgsvyptravittmkerrrgrimfvssqagqigl
dsda-sltgp---sl-t-f----tgvt d tglsksqwhisvmlsti      kr vkdvl kh       yayn m nk
 qrrqrksnklwstktrv-gv vlrfl            e ri mlm                                 
 a  endl idspmirk  al  a ak              lg af                                  
    de f c m  f a                         f  a                                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fgytayspskfalrglaeslqmegikpyniyvtvayppdtdtpglaeenktkpletklisetsgvcqpdqvakiivrdav
lslddr ddasfv ev k  fad ttnwgri slvafgavvcqy k k rgncv l vgq i tylls  rdwlvknn w
                                                                               i
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------l--lg-------r----
qgfvnfnssvgpdgymlsaltcgmspvtsiteglqqivtmglfrrqrdslfncswpsikttia-fy--sfdsivr-cmiq
e   e frv d estvrnt ma       v m  frdafve yd                vfgfasi atsltliaylt 
                                                             a   a   alalig     
                                                                                
                                                                                
                                                                                

       490 
....:....|.
           
------adkr-
reqska----e
k     tq  l
      sk   
      g    
           
           
© 1998-2022Legal notice