Dataset for protein BCL-2-like of organism Coturnix japonica

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C2T2M7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Coturnix japonica GN=BCL2L1 (length=229 residues).
MSGSNRDLVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHVVNGATVHRSSMEVHEIVGAS
DVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C2TT61_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Coturnix japonica GN=MCL-1 (length=349 residues).
MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAAATGSEVPRPLIGSAGLWASTGLAEAPRDPIGSGAAP
HSPIGSGAAPHSPIGSEFAPHSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGPGGDSLPGTPPELPDDELRR
DSLELILRYLREAAGEAEPSVKKLFPGLLGGPGRPGKTGNGVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDL
QAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVED
LEGSIRNVLMAFAGVAGLGASLAYMIRWT
>gnl|bcl2dbpro|A0A8C2TT61_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Coturnix japonica GN=MCL-1 (length=351 residues).
MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAAATGSEVPRPLIGSAGLWASTGLAEAPRDPIGSGAAP
HSPIGSGAAPHSPIGSEFAPHSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGPGGDSLPGTPPELPDDELRR
DSLELILRYLREAAGEAEPSVKKLFPGLLGGPGRPGKTGNGVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDL
QAVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVED
LEGSIRNVLMAFAGVAGLGASLAYMIRKWRS
>gnl|bcl2dbpro|A0A8C2U1A2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Coturnix japonica GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPAAAPAAVAAAGASSHHRPEPPGSAAASEVPPAEGL
RPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C2UCW6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Coturnix japonica GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESRLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFLTKFERRSPLSFSTIT
DIFAAVFSLFREYY
© 1998-2022Legal notice