Dataset for protein BCL-2-like of organism Coturnix japonica

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2UCW6_BCL2A1-      ----------METAEFYYVYYLAQDYLQYVLQESR---------------
A0A8C2TT61_MCL1-02      ------MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAA
A0A8C2TT61_MCL1-01      ------MFAVKRNAVIGFNLYCGGGGPGLVPASPAGDQPAPPAAAAAPAA
A0A8C2T2M7_BCL2L1-      ------MSGSNRDLVIDFVSY-KLSQKGHCWSELEEEDENRTDTAAEAEM
A0A8C2U1A2_BCL2-01      MAHPGRRGYDNREIVLKYIHY-KLSQRGYDWAAGEDRPPVPPALAPAAAP
                                       : :  *   .                         

A0A8C2UCW6_BCL2A1-      --------------------------------------------------
A0A8C2TT61_MCL1-02      ATGSEVPRPLIGSAGLWASTGLAEAPRDPIGSGAAPH---SPIGSGAAPH
A0A8C2TT61_MCL1-01      ATGSEVPRPLIGSAGLWASTGLAEAPRDPIGSGAAPH---SPIGSGAAPH
A0A8C2T2M7_BCL2L1-      DS--------------------------VLNGSPSWH---PPAGHVVNGA
A0A8C2U1A2_BCL2-01      AA--------------------------VAAAGASSHHRPEPPGSAAASE
                                                                          

A0A8C2UCW6_BCL2A1-      ------------LGPAQTRVA-----------------------------
A0A8C2TT61_MCL1-02      SPIGSEFAPHSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGP
A0A8C2TT61_MCL1-01      SPIGSEFAPHSLIGPATARRAPSDSTPRPVALWSPEEELDGYEPESERGP
A0A8C2T2M7_BCL2L1-      TVHRSSMEVHEIVGASDVRQA-----------------------------
A0A8C2U1A2_BCL2-01      VPPAEGLR----PAPPGVHLA-----------------------------
                                     ... .. *                             

A0A8C2UCW6_BCL2A1-      --------------------------------------------------
A0A8C2TT61_MCL1-02      GGDSLPGTPPELPDDELRRDSLELILRYLREAAGEAEPSVKKLFPGLLGG
A0A8C2TT61_MCL1-01      GGDSLPGTPPELPDDELRRDSLELILRYLREAAGEAEPSVKKLFPGLLGG
A0A8C2T2M7_BCL2L1-      --------------------------------------------------
A0A8C2U1A2_BCL2-01      --------------------------------------------------
                                                                          

A0A8C2UCW6_BCL2A1-      ----------------HVLRNIASSLQDQTEEALRPFLDRIDITSVDVAK
A0A8C2TT61_MCL1-02      PGRPGKTGNGVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDLQ
A0A8C2TT61_MCL1-01      PGRPGKTGNGVMEKALETLRRVGDGVMEKHELAFQGMLRKLEIKKEEDLQ
A0A8C2T2M7_BCL2L1-      ------------------LREAGDEFELRYRRAFSDLTSQLHITPGTAYQ
A0A8C2U1A2_BCL2-01      ------------------LRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHG
                                          **  .. .  .    :  :  .: :.      

A0A8C2UCW6_BCL2A1-      RIFNGVMEEKFADGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEEKEQI
A0A8C2TT61_MCL1-02      A-VCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKC---ISSL
A0A8C2TT61_MCL1-01      A-VCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKC---ISSL
A0A8C2T2M7_BCL2L1-      S-FEQVVNELFHDGV-NWGRIVAFFSFGGALCVESVDKEMRVL---VGRI
A0A8C2U1A2_BCL2-01      R-FVAVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPL---VDNI
                          .  *    * **  ****:.::: **. :     .            :

A0A8C2UCW6_BCL2A1-      SYFITEYIINNKAAWIDANGGWENGFLTKF--------------ERRSPL
A0A8C2TT61_MCL1-02      AGIITDALVSSKREWLMSQGGWE-GFVDFF------RVEDLEGSIRNVLM
A0A8C2TT61_MCL1-01      AGIITDALVSSKREWLMSQGGWE-GFVDFF------RVEDLEGSIRNVLM
A0A8C2T2M7_BCL2L1-      VSWMTTYLTDHLDPWIQENGGWE-RFVDLYGNNAAAELRKGQETFNKWLL
A0A8C2U1A2_BCL2-01      ATWMTEYLNRHLHNWIQDNGGWD-AFVELYGNSMRPLFDFSWISLKT-IL
                           :*  :      *:  :***:  *:  :               .   :

A0A8C2UCW6_BCL2A1-      SFSTITDIFAAVFSLFREYY-
A0A8C2TT61_MCL1-02      AFAGVAGLGASLAYMIR-WT-
A0A8C2TT61_MCL1-01      AFAGVAGLGASLAYMIRKWRS
A0A8C2T2M7_BCL2L1-      TGATVAGVLLLGSLLSRK---
A0A8C2U1A2_BCL2-01      SLVLVGACITLGAYLGHK---
                        :   :         : .    

© 1998-2022Legal notice