Dataset for protein BCL-2-like of organism Coturnix japonica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               : :  *   .                                                       
------mfavnrnavigfvlY-klsqpgyvwaspegdqpappaaaaapaaat--------------------------vi
mahpgr----ketlelyyny cggggrqldpsesa------------a----gsevprpligsaglwastglaeaprdp-
      rsysm ei fk is laqdyl hclqalrerpevrtdt pe-epds                          -l
       ggd  d   d  h      k      g ded n   l     m a                           a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 ... .. *                                       
gsgasph---spigsgaaphspigsefa-h--igpatvrrA---------------------------------------
----a--hrp------------------p-slvaasqahv psdstprpvalwspeeeldgyepesergpggdslpgtpp
ngsp-w    p p hvvnsevvpresmrv eip  pgq                                        
aa   s    e a  a  gat ha gle    l   d  l                                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          **  .. .  .    :  :  .
----------------------------------------------------------LRrvgdgvmeryerafqgmlrq
elpddelrrdslelilrylreaageaepsvkklfpgllggpgrpgktgngvmekalet  qaasefsrkhrldlsqltsk
                                                        hv  ni  slqlqtqe  rpfsgr
                                                                ed      ad  d 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: :.        .  *    * **  ****:.::: **. :     .            :   :*  :      *:  :*
lhitpetdlqr-fceVveevFsDGvtNWGRivtlfsFGgfvckhlvsinqekl---vssiagwiTeylvsskreWiqsnG
ielkkveaykaivvq aahl r  n-    vtafit  avlavesknremsvcgeeigrlvyim daitrhlhp lmeq 
 d  sgdvhgs  ng mn k h           i e   lmt k qekgvrpt   keq stf   nnn dn  dd  
     f  a    ea      a                 a      dh  ql     dn  s      id  aa   a  

       330       340       350       360       370 
....:....|....:....|....:....|....:....|....:....|.
**:  *:  :               .   ::   :         : .    
GWe-gFvdlf------rvedlegsirnvllsfatvaglgaslaylirk---
  dnr ltfygnsmrp--------lnt-pmalvgitdvltlgssmsh-wys
    a  ek   naaallrkswitfkrwi tgsl gaiilavfl g eyt 
                efdfgqe e ks         cf      f   r 
© 1998-2022Legal notice