Dataset for protein Bcl-xL of organism Chrysemys picta bellii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=236 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRSHLLSHCVSLQRPRPRLDAGCAQPRALG
© 1998-2022Legal notice