Dataset for protein Bcl-xL of organism Chrysemys picta bellii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
                                                                                

       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
************************************************  * .  ::       *  *.  .*   
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRwlLtgatla-----gvLllGsllsRk--
                                                sh lshcvslqrprpr da caqp alg
© 1998-2022Legal notice