Dataset for protein Bcl-xL of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3IUT0_BCL2L1-      MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGS
A0A8C3IUT0_BCL2L1-      MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGS
A0A8C3IUT0_BCL2L1-      MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGS
A0A8C3IUT0_BCL2L1-      MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGS
                        **************************************************

A0A8C3IUT0_BCL2L1-      PSWHPGASHVVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
A0A8C3IUT0_BCL2L1-      PSWHPGASHVVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
A0A8C3IUT0_BCL2L1-      PSWHPGASHVVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
A0A8C3IUT0_BCL2L1-      PSWHPGASHVVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRRA
                        **************************************************

A0A8C3IUT0_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A8C3IUT0_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A8C3IUT0_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A8C3IUT0_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
                        **************************************************

A0A8C3IUT0_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSR
A0A8C3IUT0_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSR
A0A8C3IUT0_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSR
A0A8C3IUT0_BCL2L1-      VDKEMQVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSR
                        **************************************************

A0A8C3IUT0_BCL2L1-      KGQEQFNRWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      KGQEQFNRWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      KGQEQFNRWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      KGQEQFNRSHLLSHCVSLQRPRPRLDAGCAQPRALG
                        ********  * .  ::       *  *.  .*   

© 1998-2022Legal notice