Dataset for protein BCL-2-like of organism Canis lupus dingo

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C0JVF6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C0JVF6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C0K082_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C0K082_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C0KQ53_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Canis lupus dingo GN=BCL2A1 (length=174 residues).
MTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFE
DGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVL
GTVCEMWSHLKQYY
>gnl|bcl2dbpro|A0A8C0KWE3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus dingo GN=BCL-2 (length=237 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASQPGRAPAPARTSPPPPPAAPAAAAAAAAA
GPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C0L4C8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus dingo GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2022Legal notice