Dataset for protein BCL-2-like of organism Canis lupus dingo

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0L4C8_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGG
A0A8C0KQ53_BCL2A1-      -----------------------MTDCEFGYTLALAQDYVRHVLQ-----
A0A8C0K082_BCL2L2-      ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
A0A8C0K082_BCL2L2-      ----------------------MATPASAPDTRALVADFVGYKLRQKGY-
A0A8C0JVF6_BCL2L1-      ---------------------------MSQSNRELVVDFLSYKLSQKGYS
A0A8C0JVF6_BCL2L1-      ---------------------------MSQSNRELVVDFLSYKLSQKGYS
A0A8C0KWE3_BCL2-01      ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
                                                          :  .            

A0A8C0L4C8_MCL1-01      GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
A0A8C0KQ53_BCL2A1-      --------------------------------------------------
A0A8C0K082_BCL2L2-      -----VCGAGPGEGP------------------------AA---------
A0A8C0K082_BCL2L2-      -----VCGAGPGEGP------------------------AA---------
A0A8C0JVF6_BCL2L1-      WSQFSDVEENRTEAP------------------------EGTESEMETPS
A0A8C0JVF6_BCL2L1-      WSQFSDVEENRTEAP------------------------EGTESEMETPS
A0A8C0KWE3_BCL2-01      W----DAGEAGAAPP------------------------GAAPAPGISAS
                                                                          

A0A8C0L4C8_MCL1-01      PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A8C0KQ53_BCL2A1-      --------------IPQPGPAPSRASRVLQDVAFSVQGQV----------
A0A8C0K082_BCL2L2-      -------------------------------------DPL----------
A0A8C0K082_BCL2L2-      -------------------------------------DPL----------
A0A8C0JVF6_BCL2L1-      AINGNPSWHLADSPAVNGATGHSSSLDAREVIPM---AAV----------
A0A8C0JVF6_BCL2L1-      AINGNPSWHLADSPAVNGATGHSSSLDAREVIPM---AAV----------
A0A8C0KWE3_BCL2-01      QPGRAPAPARTSPPPPPAAPAAAAAAAAAGPAPSPVPPVV----------
                                                               :          

A0A8C0L4C8_MCL1-01      SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
A0A8C0KQ53_BCL2A1-      --------------------------------------------------
A0A8C0K082_BCL2L2-      --------------------------------------------------
A0A8C0K082_BCL2L2-      --------------------------------------------------
A0A8C0JVF6_BCL2L1-      --------------------------------------------------
A0A8C0JVF6_BCL2L1-      --------------------------------------------------
A0A8C0KWE3_BCL2-01      --------------------------------------------------
                                                                          

A0A8C0L4C8_MCL1-01      GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVI
A0A8C0KQ53_BCL2A1-      ---------EKNLKPCLDSFDV--------------VSVDTARTIFNQVM
A0A8C0K082_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A8C0K082_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A8C0JVF6_BCL2L1-      ---------KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A8C0JVF6_BCL2L1-      ---------KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A8C0KWE3_BCL2-01      ---------HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
                                    :.   * ..               :.       :  * 

A0A8C0L4C8_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PLAESITDVL
A0A8C0KQ53_BCL2A1-      EKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFI
A0A8C0K082_BCL2L2-      DELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVG--QVQEWMVAYL
A0A8C0K082_BCL2L2-      DELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVG--QVQEWMVAYL
A0A8C0JVF6_BCL2L1-      NELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--RIAAWMATYL
A0A8C0JVF6_BCL2L1-      NELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--RIAAWMATYL
A0A8C0KWE3_BCL2-01      EELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEYL
                           * .*  ****:*:.: * . :     .   .  :    :   :.  :

A0A8C0L4C8_MCL1-01      VRTKRDWLVKQRGWDG-FVEFFHVEDLEGGI-------------RNVLLA
A0A8C0KQ53_BCL2A1-      TRNMRDWIRQNGGWENGFVKKFEPK-------------------SGWLTF
A0A8C0K082_BCL2L2-      ETRLADWIHSSGGWAE-FTALYGDGALEEARRLRE---GNWASVRTVLTG
A0A8C0K082_BCL2L2-      ETRLADWIHSSGGWAE-FTALYGDGALEEARRLRE---GNWASVRTVLTG
A0A8C0JVF6_BCL2L1-      NDHLEPWIQENGGWDT-FVELYGNNAAAESRKGQERFN------RWFLTG
A0A8C0JVF6_BCL2L1-      NDHLEPWIQENGGWDT-FVELYGNNAAAESRKGQERFN------RWFLTG
A0A8C0KWE3_BCL2-01      NRHLHTWIQDNGGWDA-FVELYGPTM-------QPLFDFSWLSLKALLSL
                              *: .. **   *.  :                         *  

A0A8C0L4C8_MCL1-01      FAGVAGVGAGLAYLIR--
A0A8C0KQ53_BCL2A1-      LEVLGTVCEMWSHLKQYY
A0A8C0K082_BCL2L2-      AVALGALVTVGAFFASK-
A0A8C0K082_BCL2L2-      AVALGALVTVGAFFASK-
A0A8C0JVF6_BCL2L1-      MT-VAGVVLLGSLFSRK-
A0A8C0JVF6_BCL2L1-      MT-VAGVVLLGSLFSRK-
A0A8C0KWE3_BCL2-01      AL-VGACITLGAYLGHK-
                           :.      : :    

© 1998-2022Legal notice