Dataset for protein BCL-2-like of organism Canis lupus dingo

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0L4C8_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGG
A0A8C0KQ53_BCL2A1-      -------------MTDCEFGY-TLALAQDYVRHVLQI-------------
A0A8C0KWE3_BCL2-01      ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAA
                                           *        .     *               

A0A8C0L4C8_MCL1-01      GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
A0A8C0KQ53_BCL2A1-      -------------------------------------------PQ-----
A0A8C0KWE3_BCL2-01      PPGAAPAPGISASQPGRAPAPARTSPPPPPAAPAAAAAAAAAGPA-----
                                                                   *      

A0A8C0L4C8_MCL1-01      PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A8C0KQ53_BCL2A1-      --------------------------------------------------
A0A8C0KWE3_BCL2-01      --------------------------------------------------
                                                                          

A0A8C0L4C8_MCL1-01      SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
A0A8C0KQ53_BCL2A1-      ----------PGPAPS----------------------------------
A0A8C0KWE3_BCL2-01      ----------PSPVPP----------------------------------
                                  *.. *.                                  

A0A8C0L4C8_MCL1-01      GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A8C0KQ53_BCL2A1-      -------RASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQV
A0A8C0KWE3_BCL2-01      -------VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATV
                                .  .*. .. ... .    :     .: :     ..  :  *

A0A8C0L4C8_MCL1-01      IVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PLAESITDV
A0A8C0KQ53_BCL2A1-      MEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEF
A0A8C0KWE3_BCL2-01      VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEY
                        :   * *** ******:.: * ..:     .   .. ::   ::  ::: 

A0A8C0L4C8_MCL1-01      LVRTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLLAF-----AGVAGV
A0A8C0KQ53_BCL2A1-      ITRNMRDWIRQNGGWENGFVKKFE-P------KSGWLTF-----LEVLGT
A0A8C0KWE3_BCL2-01      LNRHLHTWIQDNGGWD-AFVELYG-PTMQPLFDFSWLSLKALLSLALVGA
                        : *  . *: .: **: .**: :             *::       : *.

A0A8C0L4C8_MCL1-01      GAGLAYLIR---
A0A8C0KQ53_BCL2A1-      VCEMWSHLKQYY
A0A8C0KWE3_BCL2-01      CITLGAYLGHK-
                           :   :    

© 1998-2023Legal notice