Dataset for protein BCL-2-like of organism Canis lupus dingo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :  .                                          
------------------------t--ssqstrelvadfvsyklsqkgy------vvgenrgegp---------------
mfglkrnaviglnlycggaglmma-pamapdnlailvsylghvtr----swsqfsdceagptaa-pttlapdarrvarps
                     gamsgrtgyyggr aqkgkrat qrr gggeaga---------                
                       hadgefs      m  ih     e  e      i gsga s                
                       g  ca g          e               a  aa  p                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           :                    
---------ea----------------------pa---a---s--lda-e--p----pav--------------------
pigaegpnvagtpsemetpsapnrnpswhlads--vng-tgp-ss---r-vi-msvrdpllpllelvgeassgpgmdgsl
         --aeprllslaqiggasppertsp ppqaipaherasrvyqpvaspkqav                     
         s   apgila p c   a aemeg iappgmsaaeeaaglgde lg pgq                     
         g                          d      a    a  a f                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :.   * ..               :.  
-------------------------------------------------hqalreagDefetryrrafsdltsqlhvtpg
pstpppaeeeedelyrqsleiisrylreqatgakdakplggsraasrkakltmkavl svsr-f--t---maa---isvf
                                                 lkn  rc  g qln-et- qg---k dlkne
                                                 ee   q   d dv h  d ae sr      d
                                                      p                l        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :  *    * .*  ****:*:.: * . :     .   .  :    :   :.  :      *: .. **   *. 
tayqsftqVvnelFrdGv-NWGRiVaffsFggalcvesvnkemeplvs--rvaewmatylnrhlrdWiqsngGWdt-Fve
sdrtrlet sekv qg pt    l tviv eavvtkklldrrqsvdigaeqiqasvvevietrmep lhesr  aeg ta
d qki sr mdhe s   i       l e   imaah ksqniqsc d  plsyfitaf vdtkat  vqq   en   k
  vg   iv   e             a   f      ei      e  n  l    t n h   r    g    
                                                k                      a    

       330       340       350       360        
....:....|....:....|....:....|....:....|....:...
 :                         *     :.      : :    
lygpnalee-r--qe---------rwvLtgav-vggvvtlgayfsrk-
kfhng----s-rl--rfngnwasvstf slmtalaalilvwsllas-y
f edtmaagaikgrpl dfs l lknw lfllv  tcgeml f kqy 
   vkd   g               gl  afeg    cag  h ih  
    e                    a     a            g   
© 1998-2022Legal notice