Dataset for protein BCL-2-like of organism Canis lupus dingo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   *        .     *                                             
-------------mydgrtGy-trslvqsyvryvLsq-g-e------g------a---g-----p----ap-------p-
mfglkrnaviglnltccgf lgnleigmksshhr qis-y-wttrre-ggppgg-vip-ssgss-pttp--drtsvpr-s
            maha ea  dagagaad iggk lar k adagea aageaa pag iaaaq gral  aarrpap p

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             *                                                                  
---a------a--Pr-----------------------------------------------------------------
pip-egpnvs-tp qllllappcrasppeemegpaadaimspeeeldgyepeplgkrpavlpllelvgeassgpgmdgsl
aag aaaaaa ag a                                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.. *.                                          .  .*. .. ... .    :     .: :   
PspvPp-----------------------------------------vasrtLrrvgdsvqrryetnfqpmlssldvvsv
 gtp saeeeedelyrqsleiisrylreqatgakdakplggsraasrrvllv qqaafgfsgqvrrdlkgcsrqfhltpf
   a                                           k he   d   d   nh ka ae  dk  ikne

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ..  :  *:   * *** ******:.: * ..:     .   .. ::   ::  ::: : *  . *: .: **: .**
dtart-fstVvekvFsDGV-NWGRIVtvfsFggvvtkklvsrrqsslvd--pvaywvteylvRtmrdWivqngGWd-gFV
-dvksrlnr mvhl r   t      alie eaimcvhslnqnmepdieaenlslsmadvit nlht lrkqr  ena  
    gi aq i ee e   i       f a   fla e keiei  c    kefi  f n hk    qd         

       330       340       350       360  
....:....|....:....|....:....|....:....|..
: :             *::       : *.   :   :    
elfh-p------rsvwLtf-----lgvvGvvitlwyylr---
kkygvetmqpliknsl slkallsaell tgcgmgslikqyy
 f e  dleggfdfg        a a acae aah ghk 
© 1998-2023Legal notice