Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

37 sequence(s)

>gnl|bcl2dbpro|A0A3Q1LRT3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=237 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNCWSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGRYATLL
>gnl|bcl2dbpro|A0A4W2BWN1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos indicus GN=BCL-2 (length=203 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVDDRVPEPAPAH
LDPGQRRLGRCSSGCESERDTSVPVRSEWWGVAGPRVKGRPVE
>gnl|bcl2dbpro|A0A4W2BWN1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos indicus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A4W2C0F3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPVPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|A0A4W2CQV1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=185 residues).
MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLGRSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKS
LSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLE
GGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2D608_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=238 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSGMKEHRTETPEGRESDMETPNSPTVNGATGHSRSLDARKMIPMTTVKQALRE
ASNEFKLWYQQTFSDLTSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTICMKSIDKEIHVLVSQVTTSMAT
YLNNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=296 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGNQEEEEESGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2D770_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2D770_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=227 residues).
MEKEFEDGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVS
IFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIF
VPGLGFDKQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=201 residues).
MAAAVAVSGAKRSLRAELKQRLRALSAEERLRQSHLLAQKVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCF
IPRYQLQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
>gnl|bcl2dbpro|A0A4W2EB77_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=184 residues).
MVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDP
GPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWDGFCLFFPLIPPSWE
RQLVWFFLSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A4W2F845_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=236 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A4W2FG99_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|A0A4W2G6Q5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=185 residues).
MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKS
LSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLE
GGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=296 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGNQEEEEESGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=365 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEMVHEVFFG
EILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=323 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RSG
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=336 residues).
MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVRSPAWPLMPSWPCSSWPPAALFFPELWLFPS
LRPSPAPLSGRISGPHHHPAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASAPDTRALVADF
VGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGA
VALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-06 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2GX13_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A5PJR2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|E1B9B3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=248 residues).
MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQR
LLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWVSAKDAGLV
GSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
ETFLSAFM
>gnl|bcl2dbpro|F1MQX4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=190 residues).
GMLPIFSEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNE
DDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F1MV39_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=187 residues).
VADGQESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLD
EDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQP
SWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|F6R2C4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos taurus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|O02718_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos taurus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q05KI8_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos taurus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGVGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q1RMX3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos taurus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q3C2I0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos taurus GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
© 1998-2020Legal notice