Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgtvlfsghplqgwksstsawnvrdllemlnllqgfmrpsrllftasrvrspawplmpswpcsswppaalffpelwlfps
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------at-asapdtrelvadf
lrpspaplsgrisgphhhpapgppsrppflmppsfspflpvmfglkrnaviglnlycggdglmm--p--sqsnaa--m-y
                             gll i peeeedslywssltrksrypgssaasqgamagpm-----ria-k-
                                         e ppq cei qpd   vmtpghshvdgtrergh-alvgr
                                                          l earqgsatfgygv gq g k
                                                              e l   efgya l  e  
                                                                    a aa        
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lgyklrqkgy----------------------------------------------------------------------
vsfcase---geagtviggsagpsppatlapdarrvarpspigaegpdvtatptrllffaptrlasppeemespisdaim
-e-----rht                                                                      
i-tvrqrpel                                                                      
ghgpgeiv g                                                                      
emcee  d                                                                        
 k a                                                                            
 a                                                                              
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------vcgag--s--
speeeldgcepdplgkrpavrplswsqfsdveenrgeagagppgaapapgiisgnpswhladsrtspspp-----ghprs
                       eldaleissryptdqpeatesdmgtesalnsqagrtpepisqylpqtpnastkt-pk
                       y qvg ainnslrsdatlasvryenkewedelyrqsesime pnvkaatkpkapaav
                       p ls            s  ktpp m qert t egr        reqlar a edv 
                                           d      h                q  gs  s     
                                                                       p        
                                                                       g        
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                .               
---gegppadpvhqalraagdefetryrrtfsdlasqlhvtpgtaqqrftqvsdelfrdg-pnWGrivaffsFggalcae
pla----astalkatmhrvsagvqr-f--a-qgmlakrrikvesdvkslsrlmeh--qgrvvspahlatliv-aasvakk
ldprapa----ea-v--q-anrisln-et-lpeyrrc-dhrnfdvrrmaet-vv-v --pgtkm pv-sivtassfmlvh
svgpsvitmrv--l-nkee--d-keahqnv -l----p-l---l-ag--q-rlnke s ai-g  a- ---e ervater
aqevkmtvqpkaleg ghcle-l-hwn qd a- tqe e-s d-eyeppap ip   e -  -   a  vsa k tipmn
  d vss gatgey   -   k d-      e  sl   pe  p c-i -  a-   p             -   i rgd
         ge dr   l      v         m          -t  r  -                  g   g    
                        p                    e   n                              
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
svnkemep----------lv------gqvaewmvayletrlrdwihsnggw-----------------------------
lksinrssekrdddgvsrccegdpgdsplqtslatvfnrhkap-lqksr--vfthneyqkskrvsiflsmpdeieteeii
ppqttqrv       dmddi      elivaliteq-vesh-ag-ve--rk                             
fldrciaq       saem-      rr-slf-cd-ic---k- qm-q  c                             
qigeleqg          -r      ksqtfpv--f -nntht  -qe                                
deep phl          e       dd ed-t q  td  ge  kdl                                
 rv                       -a --       a  e   ra                                 
                          l-  h          d    t                                 
                                              r                                 
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------dg------------------------------------------------fvelygv-----------g---
kdifrqgka-qtseaemvhevffgeilsncdsapsspvpeeleaikarvremeeeaeklklffnevelqmnmsppe-nwg
       e-ta                             kftglygslgralaagwrgtarqhdgakeearrlrppsae
        te                               da  v   dg h   ri cpk-elesnwltfvkvqsgia
        ns                                                 ik-esssdgh d leltaper
        va                                                 s s qqqf        a il 
        sc                                                 r   ppki             
        f                                                      -n               
                                                               rt               
                                                                -               
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------nvrmvleggqe-------------vgaaitlga-f--k--
iallprtswniqqpgedevleealstggldlifvpglgfdsqltsfteamgafnrsiyvgnvdylatlvl-e-h-kg-gs
                                        ptinesfkkvardaawlltaltaggtg--ei-layhsciq
                                        kmavwiarvywyykslfslvaqvq--lie-vyfllslldc
                                        ra-pl-rlswlslllyytrcmgswdv-vyintsfiairp 
                                        --tlavqflk-nvdniwkgtvrllasnpts rkw lrqn 
                                        tisetrd--ards gavaprtkiikfkcfv aty gks  
                                         scar gpwiqc  cvng ld     sk   shi th   
                                          v-d c  -     ta         r    k c  e   
                                           g- -        h                        
                                              s                                 

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssr
rcvpvyyvgvsvsevlyedsafm                                                         
lqtlpnennhkgddret l                                                             
nklkehrs ryktps                                                                 
a   ce p q apll                                                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       730       740         
....:....|....:....|....:....
                             
-----------------------------
srfysgfnsrprgrvyrsraratswyspy
             affagg          
                  k          
                             
                             
                             
                             
                             
                             
                             
© 1998-2022Legal notice