Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgtvlfsghplqgwksstsawnvrdllemlnllqgfmrpsrllftasrvrspawplmpswpcsswppaalffpelwlfps
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------atpasapdtrelvadf
lrpspaplsgrisgphhhpapgppsrppflmppsfspflpvmfglkrnaviglnlycggdglmm----msqsnaaiamky
                             gll i peeeedslywssltrksrypgssaasqgamagptgergyrqlvgi
                                         e ppq cei qpd   vmtpghshvdgfryg-hga----
                                                          l earqgseee---vwlrsler
                                                              eelcat-fgylmw igtk
                                                                kef aedea    eav
                                                                    d aa        
                                                                      iv        
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lgyklrqkgy----------------------------------------------------------------------
vsfcaser-tgeagtviggsagpsppatlapdarrvarpspigaegpdvtatptrllffaptrlasppeemespisdaim
ie--r--pa-                                                                      
-htygqrqhl                                                                      
garv-il-kg                                                                      
e-gp  iv k                                                                      
skaa   t e                                                                      
f  e                                                                            
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------vcgag--p--
speeeldgcepdplgkrpavswsqfsdveenrgdagsappgastpapapgiisgnpswhladsrtspspp-----gh-rs
                    epdallvgsasnteppagtesdfitmgteewlnsqagrtptpneyylpktpnaftspspk
                    rllpcrasdmemnsrqedgsvr   yenksaedelyrqvfeiisqqkreaati kamdve
                    lkqr i l  derldi hlvlp   pnmgqertqtgekseshm  pn  r a  a kaa 
                      gk        ck   fflaq   e    h k    gr          q s  l e d 
                                         e                             p        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      .                                                 *       
---gegppsdpvhqalraagdefetryrrtfsdl-------lsqlh-vtpgtaqqrftqvsdelfrdg-pnwGrivaffv
plgr--aaatklketmhrvaagvqrnfetalqgmdmvklasaakrrvikvesdvkslqrlmvhv-qgrvvst hlatlis
sdapsp---raalavnqqgsnrislahqnv-pey       rrcpd lrnfdvrrmastrvn--lsepgtkp pv-sivt
lvp-avitmpvealifgeektdlke-n-qdsalc       tqeie hs rlsagiqepgleke - ailg  g-d---e
ietqkmtkpattsyg  h  ss ipe- -- nq        sl fa pl dpeyeppa  ip   e          l  -
   ep s gsiidr   l  ec  hwv lq kh        pe     e    ct  r  e    p             a
    v    g g d   d      d      e         md          wn  n  a                   
         e                                           e                          
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fggalcaesvnkemep----------lv------gqvaewmvayletrlrdwihsnggwdg-------------------
-aafvakhpksinqssekrdddgvsrccegdpgdsplqtsittvfnrhkap-lqksr--a-gtseaemvhevffgeilsn
ps-smlvrlpdttrrv       dmddi      elival-adq-veshkal-veq-yy-tq                  
 esv--ekfiqr-iqq          --      r-----l-e-icn--htggmde rceea                  
   tatm-----c-h-          m       -s tlpvc-g -dqte- qra-   va                   
   -ip-nqlge eag                  dr sfft lf t-ns-r  --k   ss                   
   i  gddeep p-                   kd ed      dk  ne  ktl   fn                   
   g     rv                        a          a  g    q                         
                                                 d    g                         
                                                      r                         
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------fvelygvsal-------egnwrsvllaltg-vg---------------a-v
cdsapsspvpeeleaikarvremeeeaeklklffneve-qesrslqprfiapqitsfe-ayaadarsiyvgnvdyggtli
           kftglygslgralaagwrytarqhqndkemnmkpplpgngntrmviaevmedsnntvltldkilva-v-
            da  v   dg h   rigckkcedettplaqrgrqssaerlsvwv-lkaw    hn l a ailtgae
                              l --ssgsrnkfdfsw-alkcwftcrmfvyl-              snik
                              s sepp-maavtytevt-k-slyc-gavqnen               dct
                              r   lnkfgw pflwa c-l qi-pq-pag-t               spf
                                  -ttqdv rse    i  iwgg-tkpwkl               rk 
                                  rl iv            eaa t r sif               l  
                                   - -             -   l   l                    
                                                   v                            
                                                   k                            

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tlgalflik-----------------------------------------------------------------------
e-elhyhgrgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfprary
-i--a-sscdqrctlpyyvghsgsdret lsafm                                              
lvyfflallp nklkehrsnryktps                                                      
ints-i---n a   ce p q apll                                                      
vdsvw krs                                                                       
sakky gkq                                                                       
g  ti th                                                                        
   hc ed                                                                        
                                                                                
                                                                                
                                                                                

       650       660       670       680
....:....|....:....|....:....|....:....|
                                        
----------------------------------------
rarttnynssrsrfysgfnsrprgrvyrsraratswyspy
                        affagg          
                             k          
                                        
                                        
                                        
                                        
                                        
                                        
                                        
                                        
© 1998-2022Legal notice