Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfglkrnaviglnlycmgaglgqgsgasspggrlstsgwnvtdrrevlnllqgpgrrrhlvpgaggeagpgapggagdyg
                gamaaaaaaahgaa wkglaaakearall mgggea tvipssalftpsrvrsedwrrvpswsp
                    tvlf   plq   s                   fm ggr g s patla a  lm rppc
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ngleseelepeelllepepepepeeepprprappgapgpgpgsgapgllppslpprppvspppssvgnqeeeeesglslh
sswpppdvtftptw lfslrtslaspsgemss ishaims perpdfce dpfgkfla rll llctrkspnspgadtsl
i a gaa fap  r f fap r  pl e ieg hhd a   e el                      eaqndpg s gpa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-matpasapdtralvadflgyklrqkgyvc-------gagp------gegpaa---------------------------
m------e--n-e--m-yvef--s-----wsqfsvrytgakagkplpsspetsgilssqpgrtpapsrtssppvpgatgh
savdggt-yt-d-iyvq----is-yrresa       dp-ddvaapgrtaaspmetpfitnnngswilqnpgtpnahaag
rshadfrgrsehgrl-ksisicaqepktqv       qvdswrtetmkastidlvaq aieg ae hkadg w ft ney
pempftmsqeaw aawtvshavrillakpq       prpenasmneeprk efl e               k       
  te mefeyvm  ieaifk eg  t  el       enlrhsdge cgtq h                   a       
  k  pc gv     r   a        lk        mkq l  d  dhl f                           
     ed i                   i         kei i  a  wdi                             
      a                                c        l                               
                                                k                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------dplhqalraagde-----ferrfrrtfsdl-------aaqlhvtpgtaqqrftqvsdelfq
srsspvrpvvpmpdeieterk----m-qv--grnvlpvqtnyqta-qemdmvklasls---i---s---s-qr-meh--r
papldapkmihl       t-aketasr-ea-     ----heq-r-g-       --kma-kne-drk-ls-lvv-vls
qk kr sifls        vlvldv-h-qstn     lylt---hsv-f       vvridlsvfdsvtiq-tg--ke e
       e           evrqvif igqnd      spwckldlak        sre r l r  wn  ep ln   -
                   ati     e k c      kh l  q nh        tq      d  cg  a  i    d
                    i      s          i     c d         pe         ye  n  e     
                    a                                   d                       
                                                        m                       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dg-pnwgrlvaffvfgaalca--------------esvnkemeplvg----wmvayletrladwihsnggw---------
grvvs---i-tlis--g----rppqttrrqekrdd------------qvqe--------h-------s---fsqtseaem
--it-t hva-i--pa-fmlv           llgkgisrdcrvmissiatslaeqfne-hrpllqe-ryy         
pa -k  g-ds-vt s vvtk              dfkdsnqslccapltllvttvicrstnaggrqk rc         
e  l      l  e e siae              hcrai ihs  kd sfficlg vnqskt qmke            
             a   t  m               d vp pd   er    t df tknkhr  vgl            
                 i                        q   d          dd  ge  kd             
                                          a               a  e    a             
                                                             d    t             
                                                                  r             

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vhevffgeilsncdsapsspvpeeleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsi
                       lhq mr agd f    trfrrtfsdlaahlksinqescie lae atdvlvrskddw
                                                     hvt g           qqrftqvs el
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------dgf--ay-----------------------------------
yvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpknvle--iefsdvesvrtslafdeslfrgrqikvipkrtnrp
iqkqrgwdgfvaff  v gaaldgfveffhvedle giae-vllfagvagkgaykgqprlnswwltqvvvnsnnlkg   
f  gpn  rl            caes nkem p v qvraymkrclssttnkpqtlrelwkfqytslkplllldvvv   
                                      etwcvsegqnqladwrhsagvrsriiclaaaaggva is   
                                      ssg    eptma   i  v g a ff   mt aetv l    
                                      q      rn r         c         g   pr      
                                              d                         a       
                                                                                
                                                                                

       570       580       590       600       610       
....:....|....:....|....:....|....:....|....:....|....:..
                                                         
--------------r---------r-vlysg-----l---gavy-sr----------
gtstygrgfprery-lretnynsv-t-----vnsra-vtv-rffr-karatswyspy
 ialtddsaleaarkaftgkwawsqsrftgafalgpriily---ai-          
 clffsq iqpswe k    sg ltllwfflsywttpyyiklyillg          
     pv    gfv          nfkevtkkiqecicr  falkgl          
      l                 de   edldc  c e  qwgshs          
                        a     ra         hs gd           
                        s                                
                                                         
                                                         
© 1998-2022Legal notice