Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL---------------
A0A4W2D770_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      ------------------MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNL
A0A4W2D6A3_BCL2L2-      ----------------MAAAAAAAAAAGAAGGRGS---------------
A0A4W2GUJ7_BCL2L2-      ----------------MAAAAAAAAAAGAAGGRGS---------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      LQGFMRPSRLLFTASRVRSPAWPLMPSWPCSSWPPAALFFPELWLFPSLR
A0A4W2D6A3_BCL2L2-      --GPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPE
A0A4W2GUJ7_BCL2L2-      --GPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPE
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      PSPAPLSGRISGPHHHPAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQ
A0A4W2D6A3_BCL2L2-      PEPEEEPPRPRAPPGAPGPGPGSGAP--------------------GNQE
A0A4W2GUJ7_BCL2L2-      PEPEEEPPRPRAPPGAPGPGPGSGAP--------------------GNQE
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      ---------------------MAAAVAVSGAKRSLRAELK-------QRL
A0A4W2DYC0_BCL2A1-      ----------MEKEFEDGIVNWGRIVTIFAFEGILTKKLL-------GKC
A0A4W2BWN1_BCL2-02      ----------MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-------DAG
A0A4W2BWN1_BCL2-01      ----------MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-------DAG
O02718_BCL2-01          ----------MAHAGGTGYDNREIVMKYIHYKLSQRGYEW-------DAG
A0A4W2GX13_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFS---DVE
A0A4W2D608_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFS---GMK
A0A4W2F845_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNP
A0A4W2CQV1_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQA-------TGA
A0A4W2G6Q5_MCL1-01      ---------------MCEEEEDELYWQSLEIISRYLREQA-------TGA
A0A4W2D770_MCL1-02      ---------------------------------------A-------TGA
A0A4W2D770_MCL1-01      NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQA-------TGA
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      PDPGSGLTPARMATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      EEEESGL--------------------------------V-------EGD
A0A4W2GUJ7_BCL2L2-      EEEESGL--------------------------------V-------EGD
A0A4W2DYC0_BCL2A1-      ------------MTDTEFGYVHGLAEDYLKYVLQ----IQ-------QPG
Q3C2I0_BCL2A1-01        ------------MTDTEFGYVHGLAEDYLKYVLQ----IQ-------QPG
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2D6A3_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2GUJ7_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
Q1RMX3_BCL2L2-01        -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
Q05KI8_BCL2L2-01        -----------MATPASAPDTRALVADFVGYKLRQKGYVC-------GAG
A0A4W2EB77_BCL2L10      -----------MVDPFRERTAR-LLMDYLEFCAREPGTPA-------PA-
A0A4W2C0F3_BCL2L10      ----SADSLHSMVDPFRERTAR-LLMDYLEFCAREPGTPV-------PA-
A0A4W2FG99_BCL2L10      ----SADSLHSMVDPFRERTAR-LLMDYLEFCAREPGTPA-------PA-
                                                                          

A0A4W2DYC0_BCL2A1-      RALSAEERLRQSHLLAQ---------------KVFTHNEYQKSKRVSIFL
A0A4W2DYC0_BCL2A1-      IASDMDMCKDISFFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFL
A0A4W2BWN1_BCL2-02      DAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVV
A0A4W2BWN1_BCL2-01      DAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVV
O02718_BCL2-01          DAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVV
A0A4W2GX13_BCL2L1-      ENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREVI
A0A4W2D608_BCL2L1-      EHRTETPEGRESDMETP------------NSPTVNGATGHSRSLDARKMI
A0A4W2F845_BCL2L1-      QWISGNPSWHLAD-----------------SPTVNGATGHSRSLDARKMI
A0A4W2CQV1_MCL1-01      KDVKPLGRSGATS-------------------------------------
A0A4W2G6Q5_MCL1-01      KDVKPLGGSGATS-------------------------------------
A0A4W2D770_MCL1-02      KDAKPLGGSGTTS-------------------------------------
A0A4W2D770_MCL1-01      KDAKPLGGSGTTS-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GDGAIE-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GDGAIE-------------------------------------
A0A4W2DYC0_BCL2A1-      S------KPSKTS-------------------------------------
Q3C2I0_BCL2A1-01        S------KPSKTS-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2D6A3_BCL2L2-      P------GEGPAA-------------------------------------
A0A4W2GUJ7_BCL2L2-      P------GEGPAA-------------------------------------
Q1RMX3_BCL2L2-01        P------GEGPAA-------------------------------------
Q05KI8_BCL2L2-01        P------GEGPAA-------------------------------------
A0A4W2EB77_BCL2L10      P------STPEAA-------------------------------------
A0A4W2C0F3_BCL2L10      P------STPEAA-------------------------------------
A0A4W2FG99_BCL2L10      P------STPEAA-------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      SMPDEIETEEIIKDIFRQGKTC-----FIPRYQLQSNHMDMVKLASPEEI
A0A4W2DYC0_BCL2A1-      SMPDEIETEEIIKDIFRQGKTC-----FIPRYQLQSNHMDMVKLASPEEI
A0A4W2BWN1_BCL2-02      HL-------T-----LRQAGDD-----FSRRYRRDFAEM-------SSQL
A0A4W2BWN1_BCL2-01      HL-------T-----LRQAGDD-----FSRRYRRDFAEM-------SSQL
O02718_BCL2-01          HL-------T-----LRQAGDD-----FSRRYRRDFAEM-------SSQL
A0A4W2GX13_BCL2L1-      PM-------AAVKQALREAGDE-----FELRYRRAFSDL-------TSQL
A0A4W2D608_BCL2L1-      PM-------TTVKQALREASNE-----FKLWYQQTFSDL-------TSQL
A0A4W2F845_BCL2L1-      PM-------TTVKQALREASNE-----FKLRYQQTFSDL-------MSQL
A0A4W2CQV1_MCL1-01      ---------RKALETLHRVGDG-----VQHNHETAFQGM-------LQKL
A0A4W2G6Q5_MCL1-01      ---------RKALETLHRVGDG-----VQHNHETAFQGM-------LQKL
A0A4W2D770_MCL1-02      ---------RKALETLRRVGDG-----VQRNHETAFQGM-------LRKL
A0A4W2D770_MCL1-01      ---------RKALETLRRVGDG-----VQRNHETAFQGM-------LRKL
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2GUJ7_BCL2L2-      ---------DP---------------------------------------
A0A4W2D6A3_BCL2L2-      ---------DP---------------------------------------
A0A4W2GUJ7_BCL2L2-      ---------DP---------------------------------------
A0A4W2DYC0_BCL2A1-      ---------RVLQDVASSVQDE-----VERTLKQCLDKF-------DV--
Q3C2I0_BCL2A1-01        ---------RVLQDVASSVQDE-----VERTLKQCLDKF-------DV--
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2D6A3_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2GUJ7_BCL2L2-      ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
Q1RMX3_BCL2L2-01        ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
Q05KI8_BCL2L2-01        ---------DPLHQAMRAAGDE-----FETRFRRTFSDL-------AAQL
A0A4W2EB77_BCL2L10      ---------VLRHVAARIQEANRNVLPLYRRCRRHRVEL-------VARM
A0A4W2C0F3_BCL2L10      ---------VLRHVAARIQEANRNVLPLYRRCRRHRVEL-------VARM
A0A4W2FG99_BCL2L10      ---------VLRHVAARIQEANRNVLPLYRRCRRHRVEL-------VARM
                                                                          

A0A4W2DYC0_BCL2A1-      ALLPRTSWNIQQPGEDEVLEEA-LSTGGLDLIFVPG--------------
A0A4W2DYC0_BCL2A1-      ALLPRTSWNIQQPGEDEVLEEA-LSTGGLDLIFVPG--------------
A0A4W2BWN1_BCL2-02      HLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCV---------
A0A4W2BWN1_BCL2-01      HLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCV---------
O02718_BCL2-01          HLTPFTARERFATVVEELFRDG-VNWGRIVAFFEFGGVMCV---------
A0A4W2GX13_BCL2L1-      HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCV---------
A0A4W2D608_BCL2L1-      RITPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTICM---------
A0A4W2F845_BCL2L1-      RITPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTLCM---------
A0A4W2CQV1_MCL1-01      DIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAK---------
A0A4W2G6Q5_MCL1-01      DIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAK---------
A0A4W2D770_MCL1-02      DIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAF------------
A0A4W2D770_MCL1-01      DIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAF------------
A0A4W2GUJ7_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2GUJ7_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2D6A3_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2GUJ7_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      -VSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTK---------
Q3C2I0_BCL2A1-01        -VSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTK---------
A0A4W2D6A3_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2D6A3_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2GUJ7_BCL2L2-      HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
Q1RMX3_BCL2L2-01        HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
Q05KI8_BCL2L2-01        HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCA---------
A0A4W2EB77_BCL2L10      A----------QRLLDE--DPG-PSWGRVASLVTFAGSLLERPPQTTRRQ
A0A4W2C0F3_BCL2L10      A----------QRLLDE--DPG-PSWGRVASLVTFAGSLLERPPQTTRRQ
A0A4W2FG99_BCL2L10      A----------QRLLDE--DPG-PSWGRVASLVTFAGSLLERPPQTTRRQ
                                                                          

A0A4W2DYC0_BCL2A1-      ------------------------LGFDKQSNRLGRGKGYY---------
A0A4W2DYC0_BCL2A1-      ------------------------LGFDKQSNRLGRGKGYY---------
A0A4W2BWN1_BCL2-02      -----DDRVPEPAP--------------AHLDPGQRRLGRC---------
A0A4W2BWN1_BCL2-01      -----ESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGW---------
O02718_BCL2-01          -----ESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGW---------
A0A4W2GX13_BCL2L1-      -----ESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGW---------
A0A4W2D608_BCL2L1-      -----KSIDKEIHVLVSQVTTSMATYLNNHLKPWIQENGGW---------
A0A4W2F845_BCL2L1-      -----KSIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGW---------
A0A4W2CQV1_MCL1-01      -----HFKSINQESCIEPLAESITDVLVRSKRDWIVKERGW---------
A0A4W2G6Q5_MCL1-01      -----HFKSINQESCIEPLAESITDVLVRSKRDWIVKERGW---------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEM
A0A4W2GUJ7_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2D6A3_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2GUJ7_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      -KLLGKCIASDMD-MCKDISFFVAEFITENTGEWIKQNGGW---------
Q3C2I0_BCL2A1-01        -KLLGKCIASDMD-MCKDISFFVAEFITENTGEWIKQNGGW---------
A0A4W2D6A3_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2D6A3_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2GUJ7_BCL2L2-      -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
Q1RMX3_BCL2L2-01        -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
Q05KI8_BCL2L2-01        -----ESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW---------
A0A4W2EB77_BCL2L10      EKRDDDGVSRDCRLLVA----LLCAQFCERHRAWLMTNGGW---------
A0A4W2C0F3_BCL2L10      -KRDDDGVSRDCRLLVA----LLCAQFCERHRAWLMANGGW---------
A0A4W2FG99_BCL2L10      -KRDDDGVSRDCRLLVA----LLCAQFCERHRAWLMANGGW---------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      ------------------------------------------------VA
A0A4W2D770_MCL1-01      ------------------------------------------------VA
A0A4W2GUJ7_BCL2L2-      VHEVFFGEILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2GUJ7_BCL2L2-      -----------------------ELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2D6A3_BCL2L2-      -----------------------ELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2GUJ7_BCL2L2-      -----------------------ELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2GUJ7_BCL2L2-      -----------------------LHQAMRAAGDEFE---TRFRRTFSDLA
A0A4W2D6A3_BCL2L2-      -----------------------ELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2GUJ7_BCL2L2-      -----------------------ELEAIKARVREMEEEAEKLKELQNEVE
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      KHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFF------
A0A4W2D770_MCL1-01      KHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFF------
A0A4W2GUJ7_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2GUJ7_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2D6A3_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2GUJ7_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2GUJ7_BCL2L2-      AQLHVTPG---------SAQQRFTQVSDELFQGGPNWGRLVAFF--VFGA
A0A4W2D6A3_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2GUJ7_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHG
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      ------------------DAYLKRCLQSQDVKPYTLALAFKEQICLQVPV
A0A4W2DYC0_BCL2A1-      ------------------DAYLKRCLQSQDVKPYTLALAFKEQICLQVPV
A0A4W2BWN1_BCL2-02      ------------------SSGCESERDTS-------VPVRSEWW----GV
A0A4W2BWN1_BCL2-01      ------------------DAFVELYGPSM-------RPLFDFSWLSLKAL
O02718_BCL2-01          ------------------DAFVELYGPSM-------RPLFDFSWLSLKAL
A0A4W2GX13_BCL2L1-      ------------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTV
A0A4W2D608_BCL2L1-      ------------------DTFVELYESNTTNESQKGQERFNSIYTTAAVA
A0A4W2F845_BCL2L1-      ------------------DTFVELYESNTTNESQKGQECFNSIYTTAAVA
A0A4W2CQV1_MCL1-01      --DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA-----------------
A0A4W2G6Q5_MCL1-01      --DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGA-----------------
A0A4W2D770_MCL1-02      ---------HVEDLEGGIRNVLLAFAGVAGVGA-----------------
A0A4W2D770_MCL1-01      ---------HVEDLEGGIRNVLLAFAGVAGVGA-----------------
A0A4W2GUJ7_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2GUJ7_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2D6A3_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2GUJ7_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2GUJ7_BCL2L2-      ALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEF-------
A0A4W2D6A3_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2GUJ7_BCL2L2-      CGSVNRVTILCDKFSGHPKGF--AYIEFSDKESVRTSLALDESLFRGRQI
A0A4W2DYC0_BCL2A1-      ------------------EN------------------------------
Q3C2I0_BCL2A1-01        ------------------EN------------------------------
A0A4W2D6A3_BCL2L2-      ------------------AEF-----------------------------
A0A4W2D6A3_BCL2L2-      ------------------AEF-----------------------------
A0A4W2GUJ7_BCL2L2-      ------------------AEF-----------------------------
Q1RMX3_BCL2L2-01        ------------------AEF-----------------------------
Q05KI8_BCL2L2-01        ------------------AEF-----------------------------
A0A4W2EB77_BCL2L10      ------------------DGF-----------------------------
A0A4W2C0F3_BCL2L10      ------------------DGF-----------------------------
A0A4W2FG99_BCL2L10      ------------------DGF-----------------------------
                                                                          

A0A4W2DYC0_BCL2A1-      NENDVKV---------------------------DEVLYEDS--------
A0A4W2DYC0_BCL2A1-      NENDVKV---------------------------DEVLYEDS--------
A0A4W2BWN1_BCL2-02      AGPRVKG---------------------------R-----------PVE-
A0A4W2BWN1_BCL2-01      LSLALVG---------------------------A-----------CITL
O02718_BCL2-01          LSLALVG---------------------------A-----------CITL
A0A4W2GX13_BCL2L1-      AGVVLLG---------------------------S--LFSRK--------
A0A4W2D608_BCL2L1-      GLANLIS---------------------------NTKLYSKLDQRCPYYV
A0A4W2F845_BCL2L1-      GLTNLIS---------------------------NTKLYSKLDQRCPYYV
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2GUJ7_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2D6A3_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2GUJ7_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2GUJ7_BCL2L2-      -----------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTV
A0A4W2D6A3_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2GUJ7_BCL2L2-      KVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR---
A0A4W2DYC0_BCL2A1-      ---------------------GFVKKFETKSGWLTFLEVTGKICETLCRL
Q3C2I0_BCL2A1-01        ---------------------GFVKKFETKSGWLTFLEVTGKICETLCRL
A0A4W2D6A3_BCL2L2-      -----------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTV
A0A4W2D6A3_BCL2L2-      -----------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTV
A0A4W2GUJ7_BCL2L2-      -----------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTV
Q1RMX3_BCL2L2-01        -----------TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTV
Q05KI8_BCL2L2-01        -----------TALYGVGALEEARRLREGNWASVRTVLTGAVALGALVTV
A0A4W2EB77_BCL2L10      -----------CLFFPL-IPPSWER---------QLVWFFLSYWTAIIII
A0A4W2C0F3_BCL2L10      -----------CLFFSQSFQPSWER---------QLVWFFLAYWTAIIII
A0A4W2FG99_BCL2L10      -----------CLFFSQSFQPSWER---------QLVWFFLAYWTAIIII
                                                                          

A0A4W2DYC0_BCL2A1-      -----------------
A0A4W2DYC0_BCL2A1-      -----------------
A0A4W2BWN1_BCL2-02      -----------------
A0A4W2BWN1_BCL2-01      GAYLGHK----------
O02718_BCL2-01          GAYLGHK----------
A0A4W2GX13_BCL2L1-      -----------------
A0A4W2D608_BCL2L1-      GHSGSDR----------
A0A4W2F845_BCL2L1-      GHSGSDR----------
A0A4W2CQV1_MCL1-01      GLAYLIR----------
A0A4W2G6Q5_MCL1-01      GLAYLIR----------
A0A4W2D770_MCL1-02      GLAYLIR----------
A0A4W2D770_MCL1-01      GLAYLIR----------
A0A4W2GUJ7_BCL2L2-      GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      GRVYRSG----------
A0A4W2D6A3_BCL2L2-      GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      GRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      GAFFASK----------
A0A4W2D6A3_BCL2L2-      GRVYRSG----------
A0A4W2GUJ7_BCL2L2-      GRVYRSG----------
A0A4W2DYC0_BCL2A1-      KQYY-------------
Q3C2I0_BCL2A1-01        KQYY-------------
A0A4W2D6A3_BCL2L2-      GAFFASK----------
A0A4W2D6A3_BCL2L2-      GAFFASK----------
A0A4W2GUJ7_BCL2L2-      GAFFASK----------
Q1RMX3_BCL2L2-01        GAFFASK----------
Q05KI8_BCL2L2-01        GAFFASK----------
A0A4W2EB77_BCL2L10      YFWIKLS----------
A0A4W2C0F3_BCL2L10      YFWIKLL----------
A0A4W2FG99_BCL2L10      YFWIKLL----------
                                         

© 1998-2022Legal notice