Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


E1B9B3_BCL2L10-01         MTEGGAMVDPFRERTARLLMDYLEFC------------------------
F1MV39_BCL2L10-01         VADGQ---ESLVERTARLLMDYLEFC------------------------
A5PJR2_MCL1-01            MF----------GLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKE
F1MQX4_MCL1-01            --------------------------------------------------
A0A3Q1LRT3_BCL2L1-01      MS----------QSNRELVVDFLSYK------------------------
Q05KI8_BCL2L2-01          MATP-ASA----PDTRALVADFVGYK------------------------
F6R2C4_BCL2-01            MAHAGGTG----YDNREIVMKYIHYK------------------------
Q05KJ0_BCL2L1-02          MS----------QSNRELVVDFLSYK------------------------
O02718_BCL2-01            MAHAGGTG----YDNREIVMKYIHYK------------------------
Q05KJ0_BCL2L1-01          MS----------QSNRELVVDFLSYK------------------------
                                                                            

E1B9B3_BCL2L10-01         ---AREP-----GTP-----------------------------------
F1MV39_BCL2L10-01         ---AREP-----GTP-----------------------------------
A5PJR2_MCL1-01            ATARREVGGGEAGTVIGGS-AGPSPPATLAPDARRVARPSPIGAEGPDVT
F1MQX4_MCL1-01            --------------------------------------------------
A0A3Q1LRT3_BCL2L1-01      ---LSQK-----GYSWSQFSVRYG--------------------------
Q05KI8_BCL2L2-01          ---LRQK-----GYVCGAG-------------------------------
F6R2C4_BCL2-01            ---LSQR-----GYEWDAGDAGAAP----------------PGAAP----
Q05KJ0_BCL2L1-02          ---LSQK-----GYSWSQFSDVEEN-----------RTEAPEGTESD--M
O02718_BCL2-01            ---LSQR-----GYEWDAGDAGAAP----------------PGAAP----
Q05KJ0_BCL2L1-01          ---LSQK-----GYSWSQFSDVEEN-----------RTEAPEGTESD--M
                                                                            

E1B9B3_BCL2L10-01         --------------------------------------------------
F1MV39_BCL2L10-01         --------------------------------------------------
A5PJR2_MCL1-01            ATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAV
F1MQX4_MCL1-01            --------------------------------------------------
A0A3Q1LRT3_BCL2L1-01      -NPQ------------------------------WISGNPSWHLADSPTV
Q05KI8_BCL2L2-01          --------------------------------------------------
F6R2C4_BCL2-01            -APG------------------------------ILSSQPGRTPAPSRTS
Q05KJ0_BCL2L1-02          ETPS------------------------------AINGNASWHLADSPAV
O02718_BCL2-01            -APG------------------------------ILSSQPGRTPAPSRTS
Q05KJ0_BCL2L1-01          ETPS------------------------------AINGNASWHLADSPAV
                                                                            

E1B9B3_BCL2L10-01         ------------------APAPSTPE------------------------
F1MV39_BCL2L10-01         ------------------APAPSTPE------------------------
A5PJR2_MCL1-01            RPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQ
F1MQX4_MCL1-01            ------------------G---MLPIFSEEEEDELYWQSLEIISRYLREQ
A0A3Q1LRT3_BCL2L1-01      N-------GATGH-----------------------------------SR
Q05KI8_BCL2L2-01          --------------------------------------------------
F6R2C4_BCL2-01            P-------PPPPA-----------------------------------AA
Q05KJ0_BCL2L1-02          N-------GATGH-----------------------------------SR
O02718_BCL2-01            P-------PPPPA-----------------------------------AA
Q05KJ0_BCL2L1-01          N-------GATGH-----------------------------------SR
                                                                            

E1B9B3_BCL2L10-01         -------A-A-------VLRHVAARIQEANRNVLPLYRRCRRHRVELVA-
F1MV39_BCL2L10-01         -------A-A-------VLRHVAARIQEANRNVLPLYRRCRRHRVELVA-
A5PJR2_MCL1-01            ATGAKDAKPLGGSGTTSRKALET--LRRVGDG---VQRNHETAFQGMLRK
F1MQX4_MCL1-01            ATGAKDVKPLGGSGATSRKALET--LHRVGDG---VQHNHETAFQGMLQK
A0A3Q1LRT3_BCL2L1-01      SLDARKMIPM-------TTVKQA--LREASNE---FKLRYQQTFSDLMSQ
Q05KI8_BCL2L2-01          --PGEGPA-A-------DPLHQA--MRAAGDE---FETRFRRTFSDLAAQ
F6R2C4_BCL2-01            AGPAPSPVP--------PVVHLT--LRQAGDD---FSRRYRRDFAEMSSQ
Q05KJ0_BCL2L1-02          SSDAREVIPM-------AAVKQA--LREAGDE---FELRYRRAFSDLTSQ
O02718_BCL2-01            AGPAPSPVP--------PVVHLT--LRQAGDD---FSRRYRRDFAEMSSQ
Q05KJ0_BCL2L1-01          SSDAREVIPM-------AAVKQA--LREAGDE---FELRYRRAFSDLTSQ
                                                :  :: ..     .  . .     :   

E1B9B3_BCL2L10-01         -------------RMAQRLLDEDPGP-SWGRVASLVTFAGSLL--ERPPQ
F1MV39_BCL2L10-01         -------------RMAQRLLDEDPGP-SWGRVASLVTFAGSLL--ERPPQ
A5PJR2_MCL1-01            LDIKNEDDVKSLSRVMVHVF-S-DGVTNWGRIVTLISFGAFVAKHLK---
F1MQX4_MCL1-01            LDIKNEDDVKSLSRVMVHVF-S-DRVTNWGRIVTLISFGAFVAKHFK---
A0A3Q1LRT3_BCL2L1-01      LRITPGTACQSFEQVINELF-R-DRV-KWGHVVAFFSFSGTLC--MK---
Q05KI8_BCL2L2-01          LHVTPGSAQQRFTQVSDELF-Q-GGP-NWGRLVAFFVFGAALC--AE---
F6R2C4_BCL2-01            LHLTPFTARGRFATVVEELF-R-DGV-NWGRIVAFFEFGGVMC--VE---
Q05KJ0_BCL2L1-02          LHITPGTAYQSFEQVVNELF-R-DGV-NWGRIVAFFSFGGALC--VE---
O02718_BCL2-01            LHLTPFTARERFATVVEELF-R-DGV-NWGRIVAFFEFGGVMC--VE---
Q05KJ0_BCL2L1-01          LHITPGTAYQSFEQVVNELF-R-DGV-NWGRIVAFFSFGGALC--VE---
                                        :  .::       .**::.::. *.. :    .   

E1B9B3_BCL2L10-01         TTRRQEKRDDDGVSRDCRLLV---ALLCAQFCER-HRAWLMTNGGWVSAK
F1MV39_BCL2L10-01         TTRRQ-KRDDDGVSRDCRLLV---ALLCAQFCER-HRAWLMANGGWD---
A5PJR2_MCL1-01            -----------SINQES--CIEPLAESITDVLVRSKRDWIVKQRGWD---
F1MQX4_MCL1-01            -----------SINQES--CIEPLAESITDVLVRSKRDWIVKERGWD---
A0A3Q1LRT3_BCL2L1-01      -----------SIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGWD---
Q05KI8_BCL2L2-01          -----------SVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA---
F6R2C4_BCL2-01            -----------SVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGWD---
Q05KJ0_BCL2L1-02          -----------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD---
O02718_BCL2-01            -----------SVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGGWD---
Q05KJ0_BCL2L1-01          -----------SVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWD---
                                     .:.::    :       .         *:  . **    

E1B9B3_BCL2L10-01         DAGLVGSLGRAHAAGWILSLLQPLIPA----ILG---KTAGLVFPLILDS
F1MV39_BCL2L10-01         --------------GFCLFFSQSFQPS----WER---QLVWFF-------
A5PJR2_MCL1-01            --------------GFVEFFHVEDLEG----GI-----RNVLL-------
F1MQX4_MCL1-01            --------------GFVEFFHVEDLEG----GI-----RNVLL-------
A0A3Q1LRT3_BCL2L1-01      --------------TFVELYESNTTNESQKGQER---FNCWSL-------
Q05KI8_BCL2L2-01          --------------EFTALYGVGALEEARRLREGNWASVRTVL-------
F6R2C4_BCL2-01            --------------AFVELYGPSMRP----LFDFSWLSLKALL-------
Q05KJ0_BCL2L1-02          --------------TFVELYGNNAAAESRKGQER---FNRWFL-------
O02718_BCL2-01            --------------AFVELYGPSMRP----LFDFSWLSLKALL-------
Q05KJ0_BCL2L1-01          --------------TFVELYGNNAAAESRKGQER---FNRWFL-------
                                         :                          .       

E1B9B3_BCL2L10-01         NNHNLLLDKIIV-SSKILISTCLTLSNQAKLKCERPNQSKPPSE------
F1MV39_BCL2L10-01         ---------LAY-WTAII------------------------II------
A5PJR2_MCL1-01            ------A--FAG-VAGV-------------------------GA------
F1MQX4_MCL1-01            ------A--FAG-VAGV-------------------------GA------
A0A3Q1LRT3_BCL2L1-01      ------TT-RLW-LFGIF------------------------LIKHIFTK
Q05KI8_BCL2L2-01          ------T--GAVALGALV------------------------TV------
F6R2C4_BCL2-01            ------S--LAL-VGACI------------------------TL------
Q05KJ0_BCL2L1-02          ------T--GMT-VAGVV------------------------LL------
O02718_BCL2-01            ------S--LAL-VGACI------------------------TL------
Q05KJ0_BCL2L1-01          ------T--GMT-VAGVV------------------------LL------
                                                                            

E1B9B3_BCL2L10-01         -----------TFLSAFM
F1MV39_BCL2L10-01         -----------YFWIKLL
A5PJR2_MCL1-01            -----------GLAYLIR
F1MQX4_MCL1-01            -----------GLAYLIR
A0A3Q1LRT3_BCL2L1-01      QPSNCTLEHLSGRYATLL
Q05KI8_BCL2L2-01          -----------GAFFASK
F6R2C4_BCL2-01            -----------GAYLGHK
Q05KJ0_BCL2L1-02          -----------GSLFSRK
O02718_BCL2-01            -----------GAYLGHK
Q05KJ0_BCL2L1-01          -----------GSLFSRK
                                            

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice