Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

37 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2GUJ7_BCL2L2-      MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVR
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      SPAWPLMPSWPCSSWPPAALFFPELWLFPSLRPSPAPLSGRISGPHHHPA
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      PGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MAAAAAA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
F1MV39_BCL2L10-01       -------------------------------------VADGQESLV----
A0A4W2C0F3_BCL2L10      -------------------------------------SADSLHSMVDPFR
A0A4W2FG99_BCL2L10      -------------------------------------SADSLHSMVDPFR
A0A4W2EB77_BCL2L10      --------------------------------------------MVDPFR
E1B9B3_BCL2L10-01       --------------------------------------MTEGGAMVDPFR
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2D6A3_BCL2L2-      -------------------------------------------MATPASA
A0A4W2GUJ7_BCL2L2-      -------------------------------------------MATPASA
Q1RMX3_BCL2L2-01        -------------------------------------------MATPASA
Q05KI8_BCL2L2-01        -------------------------------------------MATPASA
A0A4W2D770_MCL1-01      ---------------------MFGLKRNAVIGLNLYCGGAGLGQGSGASS
A5PJR2_MCL1-01          ---------------------MFGLKRNAVIGLNLYCGGAGLGQGSGASS
A0A4W2D770_MCL1-02      ---------------------MFGLKRNAVIGLNLYCGGAGLGQGSGASS
F1MQX4_MCL1-01          ---------GMLPIFSEEEEDELYWQSLEIISRYL---------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      ------------------------------------------MAHAGGTG
A0A4W2BWN1_BCL2-01      ------------------------------------------MAHAGGTG
F6R2C4_BCL2-01          ------------------------------------------MAHAGGTG
O02718_BCL2-01          ------------------------------------------MAHAGGTG
A0A4W2GX13_BCL2L1-      ------------------------------------------------MS
Q05KJ0_BCL2L1-01        ------------------------------------------------MS
Q05KJ0_BCL2L1-02        ------------------------------------------------MS
A0A4W2D608_BCL2L1-      ------------------------------------------------MS
A0A3Q1LRT3_BCL2L1-      ------------------------------------------------MS
A0A4W2F845_BCL2L1-      ------------------------------------------------MS
A0A4W2DYC0_BCL2A1-      --------------------------------------------MTDTEF
Q3C2I0_BCL2A1-01        --------------------------------------------MTDTEF
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2D6A3_BCL2L2-      AAAAGAAGGRGSGPGRRRHL------------------------------
A0A4W2GUJ7_BCL2L2-      AAAAGAAGGRGSGPGRRRHL------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
F1MV39_BCL2L10-01       ERTARLLMDYLEFCAREPGT------------------------------
A0A4W2C0F3_BCL2L10      ERTARLLMDYLEFCAREPGT------------------------------
A0A4W2FG99_BCL2L10      ERTARLLMDYLEFCAREPGT------------------------------
A0A4W2EB77_BCL2L10      ERTARLLMDYLEFCAREPGT------------------------------
E1B9B3_BCL2L10-01       ERTARLLMDYLEFCAREPGT------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2D6A3_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2GUJ7_BCL2L2-      PDTRALVADFVGYKLRQKGY------------------------------
Q1RMX3_BCL2L2-01        PDTRALVADFVGYKLRQKGY------------------------------
Q05KI8_BCL2L2-01        PDTRALVADFVGYKLRQKGY------------------------------
A0A4W2D770_MCL1-01      PGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPS
A5PJR2_MCL1-01          PGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPS
A0A4W2D770_MCL1-02      PGGRLL--------------------------------------------
F1MQX4_MCL1-01          ---REQ--------------------------------------------
A0A4W2CQV1_MCL1-01      -----------MCEEEEDEL------------------------------
A0A4W2G6Q5_MCL1-01      -----------MCEEEEDEL------------------------------
A0A4W2BWN1_BCL2-02      YDNREIVMKYIHYKLSQRGY------------------------------
A0A4W2BWN1_BCL2-01      YDNREIVMKYIHYKLSQRGY------------------------------
F6R2C4_BCL2-01          YDNREIVMKYIHYKLSQRGY------------------------------
O02718_BCL2-01          YDNREIVMKYIHYKLSQRGY------------------------------
A0A4W2GX13_BCL2L1-      QSNRELVVDFLSYKLSQKGY------------------------------
Q05KJ0_BCL2L1-01        QSNRELVVDFLSYKLSQKGY------------------------------
Q05KJ0_BCL2L1-02        QSNRELVVDFLSYKLSQKGY------------------------------
A0A4W2D608_BCL2L1-      QSNRELVVDFLSYKLSQKGY------------------------------
A0A3Q1LRT3_BCL2L1-      QSNRELVVDFLSYKLSQKGY------------------------------
A0A4W2F845_BCL2L1-      QSNRELVVDFLSYKLSQKGY------------------------------
A0A4W2DYC0_BCL2A1-      GYVHGLAEDYLKYVLQI---------------------------------
Q3C2I0_BCL2A1-01        GYVHGLAEDYLKYVLQI---------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2D770_MCL1-01      PIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCE
A5PJR2_MCL1-01          PIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCE
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2D770_MCL1-01      PDPLGKRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSL
A5PJR2_MCL1-01          PDPLGKRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSL
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A4W2CQV1_MCL1-01      -------------YWQSLEIISRYLREQATGAKD----------------
A0A4W2G6Q5_MCL1-01      -------------YWQSLEIISRYLREQATGAKD----------------
A0A4W2BWN1_BCL2-02      -------------EWDA--------GDAGAAPPGAAPAPGILSSQPGRTP
A0A4W2BWN1_BCL2-01      -------------EWDA--------GDAGAAPPGAAPAPGILSSQPGRTP
F6R2C4_BCL2-01          -------------EWDA--------GDAGAAPPGAAPAPGILSSQPGRTP
O02718_BCL2-01          -------------EWDA--------GDAGAAPPGAAPAPGILSSQPGRTP
A0A4W2GX13_BCL2L1-      -------------SWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHL
Q05KJ0_BCL2L1-01        -------------SWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHL
Q05KJ0_BCL2L1-02        -------------SWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHL
A0A4W2D608_BCL2L1-      -------------SWSQFS-----------------GMKEHRTETPEGRE
A0A3Q1LRT3_BCL2L1-      -------------SWSQFS--------------VRYGNPQWISGNPSWHL
A0A4W2F845_BCL2L1-      -------------SWSQFS--------------VRYGNPQWISGNPSWHL
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2D6A3_BCL2L2-      ----------VPGAGGEA-----GEGAPGGAGDYGNGLESEELEP-----
A0A4W2GUJ7_BCL2L2-      ----------VPGAGGEA-----GEGAPGGAGDYGNGLESEELEP-----
A0A4W2GUJ7_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2D6A3_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2GUJ7_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2GUJ7_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
F1MV39_BCL2L10-01       -----------------------PAPAPSTPEAAVLRHVAARIQEANRNV
A0A4W2C0F3_BCL2L10      -----------------------PVPAPSTPEAAVLRHVAARIQEANRNV
A0A4W2FG99_BCL2L10      -----------------------PAPAPSTPEAAVLRHVAARIQEANRNV
A0A4W2EB77_BCL2L10      -----------------------PAPAPSTPEAAVLRHVAARIQEANRNV
E1B9B3_BCL2L10-01       -----------------------PAPAPSTPEAAVLRHVAARIQEANRNV
A0A4W2D6A3_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2D6A3_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2GUJ7_BCL2L2-      ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
Q1RMX3_BCL2L2-01        ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
Q05KI8_BCL2L2-01        ----------VCGAG--P-----GEGPAADPLHQAMRAAGDEFETRFRRT
A0A4W2D770_MCL1-01      EIISQYLREQATGAK--DAKPLGGSGTTSRKALETLRRVGDGVQRNHETA
A5PJR2_MCL1-01          EIISQYLREQATGAK--DAKPLGGSGTTSRKALETLRRVGDGVQRNHETA
A0A4W2D770_MCL1-02      ----------ATGAK--DAKPLGGSGTTSRKALETLRRVGDGVQRNHETA
F1MQX4_MCL1-01          ----------ATGAK--DVKPLGGSGATSRKALETLHRVGDGVQHNHETA
A0A4W2CQV1_MCL1-01      -------VKPLGRSGATSRKALE-----------TLHRVGDGVQHNHETA
A0A4W2G6Q5_MCL1-01      -------VKPLGGSGATSRKALE-----------TLHRVGDGVQHNHETA
A0A4W2BWN1_BCL2-02      APSRTSPPPPPAAAAGPAPSPVP------PVVHLTLRQAGDDFSRRYRRD
A0A4W2BWN1_BCL2-01      APSRTSPPPPPAAAAGPAPSPVP------PVVHLTLRQAGDDFSRRYRRD
F6R2C4_BCL2-01          APSRTSPPPPPAAAAGPAPSPVP------PVVHLTLRQAGDDFSRRYRRD
O02718_BCL2-01          APSRTSPPPPPAAAAGPAPSPVP------PVVHLTLRQAGDDFSRRYRRD
A0A4W2GX13_BCL2L1-      AD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRA
Q05KJ0_BCL2L1-01        AD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRA
Q05KJ0_BCL2L1-02        AD-----SPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRA
A0A4W2D608_BCL2L1-      SDMETPNSPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLWYQQT
A0A3Q1LRT3_BCL2L1-      AD-----SPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLRYQQT
A0A4W2F845_BCL2L1-      AD-----SPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLRYQQT
A0A4W2DYC0_BCL2A1-      -------QQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDV-----
Q3C2I0_BCL2A1-01        -------QQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDV-----
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2D6A3_BCL2L2-      -EELLLEPEPEPEPEEEPPRPRAP---PGA-PGPGP-------GSGAPGN
A0A4W2GUJ7_BCL2L2-      -EELLLEPEPEPEPEEEPPRPRAP---PGA-PGPGP-------GSGAPGN
A0A4W2GUJ7_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2D6A3_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2GUJ7_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2GUJ7_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
F1MV39_BCL2L10-01       LPLYRRCRRHRVELVARMAQRLLDE---DPGPSWGRVASLVTFAGSLLER
A0A4W2C0F3_BCL2L10      LPLYRRCRRHRVELVARMAQRLLDE---DPGPSWGRVASLVTFAGSLLER
A0A4W2FG99_BCL2L10      LPLYRRCRRHRVELVARMAQRLLDE---DPGPSWGRVASLVTFAGSLLER
A0A4W2EB77_BCL2L10      LPLYRRCRRHRVELVARMAQRLLDE---DPGPSWGRVASLVTFAGSLLER
E1B9B3_BCL2L10-01       LPLYRRCRRHRVELVARMAQRLLDE---DPGPSWGRVASLVTFAGSLLER
A0A4W2D6A3_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2D6A3_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2GUJ7_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
Q1RMX3_BCL2L2-01        FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
Q05KI8_BCL2L2-01        FSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAE
A0A4W2D770_MCL1-01      FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH
A5PJR2_MCL1-01          FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH
A0A4W2D770_MCL1-02      FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKH
F1MQX4_MCL1-01          FQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKH
A0A4W2CQV1_MCL1-01      FQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKH
A0A4W2G6Q5_MCL1-01      FQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKH
A0A4W2BWN1_BCL2-02      FAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVD
A0A4W2BWN1_BCL2-01      FAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVE
F6R2C4_BCL2-01          FAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVE
O02718_BCL2-01          FAEMSSQLHLTPFTARERFATVVEELFRDG-VNWGRIVAFFEFGGVMCVE
A0A4W2GX13_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE
Q05KJ0_BCL2L1-01        FSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE
Q05KJ0_BCL2L1-02        FSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVE
A0A4W2D608_BCL2L1-      FSDLTSQLRITPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTICMK
A0A3Q1LRT3_BCL2L1-      FSDLMSQLRITPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTLCMK
A0A4W2F845_BCL2L1-      FSDLMSQLRITPGTACQSFEQVINELFRDR-VKWGHVVAFFSFSGTLCMK
A0A4W2DYC0_BCL2A1-      ---------VSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKK
Q3C2I0_BCL2A1-01        ---------VSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKK
A0A4W2DYC0_BCL2A1-      ---------------------------------MAAAVAVSGAKRSLRAE
A0A4W2DYC0_BCL2A1-      ----------------------MEKEFEDGIVNWGRIVTIFAFEGILTKK
                                                          .               

A0A4W2GUJ7_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2D6A3_BCL2L2-      QEEEEESG----------LVEGDPGDGAIEDP------------------
A0A4W2GUJ7_BCL2L2-      QEEEEESG----------LVEGDPGDGAIEDP------------------
A0A4W2GUJ7_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2D6A3_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2GUJ7_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2GUJ7_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
F1MV39_BCL2L10-01       PPQTTRRQ-KRDDDGVSRDC------RLLVALLCAQFCERHRAWLMANGG
A0A4W2C0F3_BCL2L10      PPQTTRRQ-KRDDDGVSRDC------RLLVALLCAQFCERHRAWLMANGG
A0A4W2FG99_BCL2L10      PPQTTRRQ-KRDDDGVSRDC------RLLVALLCAQFCERHRAWLMANGG
A0A4W2EB77_BCL2L10      PPQTTRRQEKRDDDGVSRDC------RLLVALLCAQFCERHRAWLMTNGG
E1B9B3_BCL2L10-01       PPQTTRRQEKRDDDGVSRDC------RLLVALLCAQFCERHRAWLMTNGG
A0A4W2D6A3_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2D6A3_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2GUJ7_BCL2L2-      SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
Q1RMX3_BCL2L2-01        SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
Q05KI8_BCL2L2-01        SVNKEMEP----------LV------GQVQEWMVAYLETRLADWIHSSGG
A0A4W2D770_MCL1-01      LKSINQES----------CI------EPLAESITDVLVRSKRDWIVKQRG
A5PJR2_MCL1-01          LKSINQES----------CI------EPLAESITDVLVRSKRDWIVKQRG
A0A4W2D770_MCL1-02      LKSINQES----------CI------EPLAESITDVLVRSKRDWIVKQRG
F1MQX4_MCL1-01          FKSINQES----------CI------EPLAESITDVLVRSKRDWIVKERG
A0A4W2CQV1_MCL1-01      FKSINQES----------CI------EPLAESITDVLVRSKRDWIVKERG
A0A4W2G6Q5_MCL1-01      FKSINQES----------CI------EPLAESITDVLVRSKRDWIVKERG
A0A4W2BWN1_BCL2-02      DRVPEPAP------------------------------AHLDPGQRRLGR
A0A4W2BWN1_BCL2-01      SVNREMSP----------LV------DSIALWMTEYLNRHLHTWIQDNGG
F6R2C4_BCL2-01          SVNREMSP----------LV------DSIALWMTEYLNRHLHTWIQDNGG
O02718_BCL2-01          SVNREMSP----------LV------DSIALWMTEYLNRHLHTWIQDNGG
A0A4W2GX13_BCL2L1-      SVDKEMQV----------LV------SRIATWMATYLNDHLEPWIQENGG
Q05KJ0_BCL2L1-01        SVDKEMQV----------LV------SRIATWMATYLNDHLEPWIQENGG
Q05KJ0_BCL2L1-02        SVDKEMQV----------LV------SRIATWMATYLNDHLEPWIQENGG
A0A4W2D608_BCL2L1-      SIDKEIHV----------LV------SQVTTSMATYLNNHLKPWIQENGG
A0A3Q1LRT3_BCL2L1-      SIDKEIHV----------LV------SQVTTSTATYLNNHLKPWIQENGG
A0A4W2F845_BCL2L1-      SIDKEIHV----------LV------SQVTTSTATYLNNHLKPWIQENGG
A0A4W2DYC0_BCL2A1-      LLGKCIAS-------DMDMC------KDISFFVAEFITENTGEWIKQNGG
Q3C2I0_BCL2A1-01        LLGKCIAS-------DMDMC------KDISFFVAEFITENTGEWIKQNGG
A0A4W2DYC0_BCL2A1-      LKQRLRAL-------SAEER------LRQSHLLAQ---------------
A0A4W2DYC0_BCL2A1-      LLGKCIAS-------DMDMC------KDISFFVAEFITENTGEWIKQNGG
                                                                          

A0A4W2GUJ7_BCL2L2-      W-------------------------------------A-----------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      W-------------------------------------FSQTSEAEMVHE
A0A4W2D6A3_BCL2L2-      W-------------------------------------------------
A0A4W2GUJ7_BCL2L2-      W-------------------------------------------------
A0A4W2GUJ7_BCL2L2-      W-------------------------------------------------
F1MV39_BCL2L10-01       W-------------------------------------DG----------
A0A4W2C0F3_BCL2L10      W-------------------------------------DG----------
A0A4W2FG99_BCL2L10      W-------------------------------------DG----------
A0A4W2EB77_BCL2L10      W-------------------------------------DG----------
E1B9B3_BCL2L10-01       W-------------------------------------VSA---------
A0A4W2D6A3_BCL2L2-      W-------------------------------------AE----------
A0A4W2D6A3_BCL2L2-      W-------------------------------------AE----------
A0A4W2GUJ7_BCL2L2-      W-------------------------------------AE----------
Q1RMX3_BCL2L2-01        W-------------------------------------AE----------
Q05KI8_BCL2L2-01        W-------------------------------------AE----------
A0A4W2D770_MCL1-01      W-------------------------------------DG----------
A5PJR2_MCL1-01          W-------------------------------------DG----------
A0A4W2D770_MCL1-02      W-------------------------------------DG----------
F1MQX4_MCL1-01          W-------------------------------------DG----------
A0A4W2CQV1_MCL1-01      W-------------------------------------DG----------
A0A4W2G6Q5_MCL1-01      W-------------------------------------DG----------
A0A4W2BWN1_BCL2-02      C-------------------------------------SS----------
A0A4W2BWN1_BCL2-01      W-------------------------------------DA----------
F6R2C4_BCL2-01          W-------------------------------------DA----------
O02718_BCL2-01          W-------------------------------------DA----------
A0A4W2GX13_BCL2L1-      W-------------------------------------DT----------
Q05KJ0_BCL2L1-01        W-------------------------------------DT----------
Q05KJ0_BCL2L1-02        W-------------------------------------DT----------
A0A4W2D608_BCL2L1-      W-------------------------------------DT----------
A0A3Q1LRT3_BCL2L1-      W-------------------------------------DT----------
A0A4W2F845_BCL2L1-      W-------------------------------------DT----------
A0A4W2DYC0_BCL2A1-      W------------------------------------ENG----------
Q3C2I0_BCL2A1-01        W------------------------------------ENG----------
A0A4W2DYC0_BCL2A1-      KVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTC----------
A0A4W2DYC0_BCL2A1-      WVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTC----------
                                                                          

A0A4W2GUJ7_BCL2L2-      --------------------EFTALYG--DGALEEARRLRE---------
A0A4W2D6A3_BCL2L2-      --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
A0A4W2GUJ7_BCL2L2-      --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
A0A4W2GUJ7_BCL2L2-      VFFGEILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQM
A0A4W2D6A3_BCL2L2-      --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
A0A4W2GUJ7_BCL2L2-      --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
A0A4W2GUJ7_BCL2L2-      --------------------ELEAIKARVREMEEEAEKLKELQNEVEKQM
F1MV39_BCL2L10-01       --------------------------------------FCLFFSQSF---
A0A4W2C0F3_BCL2L10      --------------------------------------FCLFFSQSF---
A0A4W2FG99_BCL2L10      --------------------------------------FCLFFSQSF---
A0A4W2EB77_BCL2L10      --------------------------------------FCLFFPL-I---
E1B9B3_BCL2L10-01       --------------------KDAGLVGSLGRAHAAGWILSLLQPL-I---
A0A4W2D6A3_BCL2L2-      --------------------------------------FTALYGDGALEE
A0A4W2D6A3_BCL2L2-      --------------------------------------FTALYGDGALEE
A0A4W2GUJ7_BCL2L2-      --------------------------------------FTALYGDGALEE
Q1RMX3_BCL2L2-01        --------------------------------------FTALYGDGALEE
Q05KI8_BCL2L2-01        --------------------------------------FTALYGVGALEE
A0A4W2D770_MCL1-01      --------------------------------------FVEFFHVEDL--
A5PJR2_MCL1-01          --------------------------------------FVEFFHVEDL--
A0A4W2D770_MCL1-02      --------------------------------------FVEFFHVEDL--
F1MQX4_MCL1-01          --------------------------------------FVEFFHVEDL--
A0A4W2CQV1_MCL1-01      --------------------------------------FVEFFHV-----
A0A4W2G6Q5_MCL1-01      --------------------------------------FVEFFHV-----
A0A4W2BWN1_BCL2-02      --------------------------------------GCESERD-----
A0A4W2BWN1_BCL2-01      --------------------------------------FVELYGP-----
F6R2C4_BCL2-01          --------------------------------------FVELYGP-----
O02718_BCL2-01          --------------------------------------FVELYGP-----
A0A4W2GX13_BCL2L1-      --------------------------------------FVELYGN-----
Q05KJ0_BCL2L1-01        --------------------------------------FVELYGN-----
Q05KJ0_BCL2L1-02        --------------------------------------FVELYGN-----
A0A4W2D608_BCL2L1-      --------------------------------------FVELYES-----
A0A3Q1LRT3_BCL2L1-      --------------------------------------FVELYES-----
A0A4W2F845_BCL2L1-      --------------------------------------FVELYES-----
A0A4W2DYC0_BCL2A1-      --------------------------------------FVKKFETKSGWL
Q3C2I0_BCL2A1-01        --------------------------------------FVKKFETKSGWL
A0A4W2DYC0_BCL2A1-      --------------------------------------FIPRYQLQSNHM
A0A4W2DYC0_BCL2A1-      --------------------------------------FIPRYQLQSNHM
                                                                          

A0A4W2GUJ7_BCL2L2-      ------GNWA----------------------------------------
A0A4W2D6A3_BCL2L2-      NMSPPPGNAG----------------------------------------
A0A4W2GUJ7_BCL2L2-      NMSPPPGNAG----------------------------------------
A0A4W2GUJ7_BCL2L2-      NMSPPPGNAG----------------------------------------
A0A4W2D6A3_BCL2L2-      NMSPPPGNAG----------------------------------------
A0A4W2GUJ7_BCL2L2-      NMSPPPGNAG----------------------------------------
A0A4W2GUJ7_BCL2L2-      NMSPPPGNAG----------------------------------------
F1MV39_BCL2L10-01       -----QPSWE----------------------------------------
A0A4W2C0F3_BCL2L10      -----QPSWE----------------------------------------
A0A4W2FG99_BCL2L10      -----QPSWE----------------------------------------
A0A4W2EB77_BCL2L10      -----PPSWE----------------------------------------
E1B9B3_BCL2L10-01       -----PAILG----------------------------------------
A0A4W2D6A3_BCL2L2-      ARRLREGNWA----------------------------------------
A0A4W2D6A3_BCL2L2-      ARRLREGNWA----------------------------------------
A0A4W2GUJ7_BCL2L2-      ARRLREGNWA----------------------------------------
Q1RMX3_BCL2L2-01        ARRLREGNWA----------------------------------------
Q05KI8_BCL2L2-01        ARRLREGNWA----------------------------------------
A0A4W2D770_MCL1-01      -----EGGIR----------------------------------------
A5PJR2_MCL1-01          -----EGGIR----------------------------------------
A0A4W2D770_MCL1-02      -----EGGIR----------------------------------------
F1MQX4_MCL1-01          -----EGGIR----------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
A0A4W2D608_BCL2L1-      --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
A0A4W2F845_BCL2L1-      --------------------------------------------------
A0A4W2DYC0_BCL2A1-      TFLEVTG-------------------------------------------
Q3C2I0_BCL2A1-01        TFLEVTG-------------------------------------------
A0A4W2DYC0_BCL2A1-      DMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFD
A0A4W2DYC0_BCL2A1-      DMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFD
                                                                          

A0A4W2GUJ7_BCL2L2-      SV------------RTVLTGAVALGALVTV--------------------
A0A4W2D6A3_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A4W2GUJ7_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A4W2GUJ7_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A4W2D6A3_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A4W2GUJ7_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
A0A4W2GUJ7_BCL2L2-      PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDK
F1MV39_BCL2L10-01       RQLVWFFLAYW--------------TAIIIIYFWIKLL------------
A0A4W2C0F3_BCL2L10      RQLVWFFLAYW--------------TAIIIIYFWIKLL------------
A0A4W2FG99_BCL2L10      RQLVWFFLAYW--------------TAIIIIYFWIKLL------------
A0A4W2EB77_BCL2L10      RQLVWFFLSYW--------------TAIIIIYFWIKLS------------
E1B9B3_BCL2L10-01       KTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQ
A0A4W2D6A3_BCL2L2-      SVRTVLTGAVA-------------LGALVTVGAFFASK------------
A0A4W2D6A3_BCL2L2-      SVRTVLTGAVA-------------LGALVTVGAFFASK------------
A0A4W2GUJ7_BCL2L2-      SVRTVLTGAVA-------------LGALVTVGAFFASK------------
Q1RMX3_BCL2L2-01        SVRTVLTGAVA-------------LGALVTVGAFFASK------------
Q05KI8_BCL2L2-01        SVRTVLTGAVA-------------LGALVTVGAFFASK------------
A0A4W2D770_MCL1-01      NVLLAFAGVAG-------------VGA----GLAYLIR------------
A5PJR2_MCL1-01          NVLLAFAGVAG-------------VGA----GLAYLIR------------
A0A4W2D770_MCL1-02      NVLLAFAGVAG-------------VGA----GLAYLIR------------
F1MQX4_MCL1-01          NVLLAFAGVAG-------------VGA----GLAYLIR------------
A0A4W2CQV1_MCL1-01      ---EDLEGGIRNVLLAFAGVAGVGAGLAYLIR------------------
A0A4W2G6Q5_MCL1-01      ---EDLEGGIRNVLLAFAGVAGVGAGLAYLIR------------------
A0A4W2BWN1_BCL2-02      TSVPVRSEWW----GVAGPRV---KGRPVE--------------------
A0A4W2BWN1_BCL2-01      SMRPLFDFSWLSLKALLSLAL---VGACITLGAYLGHK------------
F6R2C4_BCL2-01          SMRPLFDFSWLSLKALLSLAL---VGACITLGAYLGHK------------
O02718_BCL2-01          SMRPLFDFSWLSLKALLSLAL---VGACITLGAYLGHK------------
A0A4W2GX13_BCL2L1-      NAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK------------
Q05KJ0_BCL2L1-01        NAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK------------
Q05KJ0_BCL2L1-02        NAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK------------
A0A4W2D608_BCL2L1-      NTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRC--PYYVGH
A0A3Q1LRT3_BCL2L1-      NTTNESQKGQERFNC-WSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGR
A0A4W2F845_BCL2L1-      NTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRC--PYYVGH
A0A4W2DYC0_BCL2A1-      KICETLCRLKQYY-------------------------------------
Q3C2I0_BCL2A1-01        KICETLCRLKQYY-------------------------------------
A0A4W2DYC0_BCL2A1-      KQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDV
A0A4W2DYC0_BCL2A1-      KQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDV
                                                                          

A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A4W2GUJ7_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A4W2GUJ7_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A4W2D6A3_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A4W2GUJ7_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
A0A4W2GUJ7_BCL2L2-      FSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT
F1MV39_BCL2L10-01       --------------------------------------------------
A0A4W2C0F3_BCL2L10      --------------------------------------------------
A0A4W2FG99_BCL2L10      --------------------------------------------------
A0A4W2EB77_BCL2L10      --------------------------------------------------
E1B9B3_BCL2L10-01       SKPPSETFLSAFM-------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2D6A3_BCL2L2-      --------------------------------------------------
A0A4W2GUJ7_BCL2L2-      --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
A0A4W2D770_MCL1-01      --------------------------------------------------
A5PJR2_MCL1-01          --------------------------------------------------
A0A4W2D770_MCL1-02      --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
A0A4W2CQV1_MCL1-01      --------------------------------------------------
A0A4W2G6Q5_MCL1-01      --------------------------------------------------
A0A4W2BWN1_BCL2-02      --------------------------------------------------
A0A4W2BWN1_BCL2-01      --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
A0A4W2GX13_BCL2L1-      --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
A0A4W2D608_BCL2L1-      SGSDR---------------------------------------------
A0A3Q1LRT3_BCL2L1-      YATLL---------------------------------------------
A0A4W2F845_BCL2L1-      SGSDR---------------------------------------------
A0A4W2DYC0_BCL2A1-      --------------------------------------------------
Q3C2I0_BCL2A1-01        --------------------------------------------------
A0A4W2DYC0_BCL2A1-      KVDEVLYEDS----------------------------------------
A0A4W2DYC0_BCL2A1-      KVDEVLYEDS----------------------------------------
                                                                          

A0A4W2GUJ7_BCL2L2-      --------------------------------GAFFASK----------
A0A4W2D6A3_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A4W2GUJ7_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
A0A4W2GUJ7_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4W2D6A3_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A4W2GUJ7_BCL2L2-      DRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
F1MV39_BCL2L10-01       -------------------------------------------------
A0A4W2C0F3_BCL2L10      -------------------------------------------------
A0A4W2FG99_BCL2L10      -------------------------------------------------
A0A4W2EB77_BCL2L10      -------------------------------------------------
E1B9B3_BCL2L10-01       -------------------------------------------------
A0A4W2D6A3_BCL2L2-      -------------------------------------------------
A0A4W2D6A3_BCL2L2-      -------------------------------------------------
A0A4W2GUJ7_BCL2L2-      -------------------------------------------------
Q1RMX3_BCL2L2-01        -------------------------------------------------
Q05KI8_BCL2L2-01        -------------------------------------------------
A0A4W2D770_MCL1-01      -------------------------------------------------
A5PJR2_MCL1-01          -------------------------------------------------
A0A4W2D770_MCL1-02      -------------------------------------------------
F1MQX4_MCL1-01          -------------------------------------------------
A0A4W2CQV1_MCL1-01      -------------------------------------------------
A0A4W2G6Q5_MCL1-01      -------------------------------------------------
A0A4W2BWN1_BCL2-02      -------------------------------------------------
A0A4W2BWN1_BCL2-01      -------------------------------------------------
F6R2C4_BCL2-01          -------------------------------------------------
O02718_BCL2-01          -------------------------------------------------
A0A4W2GX13_BCL2L1-      -------------------------------------------------
Q05KJ0_BCL2L1-01        -------------------------------------------------
Q05KJ0_BCL2L1-02        -------------------------------------------------
A0A4W2D608_BCL2L1-      -------------------------------------------------
A0A3Q1LRT3_BCL2L1-      -------------------------------------------------
A0A4W2F845_BCL2L1-      -------------------------------------------------
A0A4W2DYC0_BCL2A1-      -------------------------------------------------
Q3C2I0_BCL2A1-01        -------------------------------------------------
A0A4W2DYC0_BCL2A1-      -------------------------------------------------
A0A4W2DYC0_BCL2A1-      -------------------------------------------------
                                                                         

© 1998-2022Legal notice