Dataset for protein BCL-2-like of organism Bos mutus grunniens

[Download (right click)] [Alignment] [Repertoires]

15 sequence(s)

>gnl|bcl2dbpro|A0A4P8GLJ2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8B9W7D1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos mutus grunniens GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8B9W7D1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos mutus grunniens GN=MCL-1 (length=354 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAVDTRLYTEPADVMVCNLV
>gnl|bcl2dbpro|A0A8B9W7D1_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos mutus grunniens GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8B9W7D1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos mutus grunniens GN=MCL-1 (length=316 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWVSLF
>gnl|bcl2dbpro|A0A8B9WB42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=236 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDAQKTIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSMATYL
NNHVKPWIQENGGWDTFVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A8B9WT05_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8B9X9C2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=217 residues).
KFILQGKGYSNRRLVVDFLSYKLSQKGYSWSRFNDVEENRTEASEGTKSDMETPMPSMTTHLATGHSRSLDAWKVIPVTT
EKQALREAGNDDQTSQLHITPGTAYQSFEQMMYELLQDGVNWGRIVAFFSFSGALCMESIDKETQVLVSQSTTWMATYLN
DHLESWIQENGGWDTSVKLCENNTTTESQKGQERFNSWSLTGMTSAGTALLGLLLNS
>gnl|bcl2dbpro|A0A8B9XQH5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B9Y853_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L10 (length=232 residues).
MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL
YRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHR
AWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAIIIIYFWIKLSFLHIGPVFLPDVFQLFDLRHHWE
>gnl|bcl2dbpro|A0A8B9Y853_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L10 (length=232 residues).
MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL
YRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHR
AWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAIIIIYFWIKLSANMDPAKLVSSQGNNICVDKKPA
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=236 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMP
DEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTVAVCLVMSE
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=301 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMP
DEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGF
DKQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=201 residues).
MAAAVAVSGAKRSLRAELKQRLRALSAEERLRQSHLLAQKVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCF
IPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
© 1998-2022Legal notice