Dataset for protein BCL-2-like of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4P8GLJ2_BCL2-01      MAHAGGTGYDNR----------------------EIVMKYIHYKLSQRGY
A0A8B9Y853_BCL2L10      MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPG-
A0A8B9Y853_BCL2L10      MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPG-
A0A8B9X9C2_BCL2L1-      KFILQGKGYSNR----------------------RLVVDFLSYKLSQKGY
A0A8B9WB42_BCL2L1-      ------MSQSNR----------------------ELVVDFLSYKLSQKGY
A0A8B9XQH5_BCL2L1-      ------MSQSNR----------------------ELVVDFLSYKLSQKGY
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      ------------------------MTDTEFGYVHGLAEDYLKYVLQIQQ-
A0A8B9YDG7_BCL2A1-      ------------------------MTDTEFGYVHGLAEDYLKYVLQIQQ-
A0A8B9YDG7_BCL2A1-      ------------------------MTDTEFGYVHGLAEDYLKYVLQIQQ-
A0A8B9WT05_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A8B9W7D1_MCL1-04      -MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLL--------------
A0A8B9W7D1_MCL1-02      -MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGG
A0A8B9W7D1_MCL1-03      -MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGG
A0A8B9W7D1_MCL1-01      -MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGG
                                                                          

A0A4P8GLJ2_BCL2-01      --------------------------------------------------
A0A8B9Y853_BCL2L10      --------------------------------------------------
A0A8B9Y853_BCL2L10      --------------------------------------------------
A0A8B9X9C2_BCL2L1-      --------------------------------------------------
A0A8B9WB42_BCL2L1-      --------------------------------------------------
A0A8B9XQH5_BCL2L1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9WT05_BCL2L2-      --------------------------------------------------
A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      GEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFA
A0A8B9W7D1_MCL1-03      GEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFA
A0A8B9W7D1_MCL1-01      GEAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFA
                                                                          

A0A4P8GLJ2_BCL2-01      ---------------------------------------------EWD--
A0A8B9Y853_BCL2L10      --------------------------------------------------
A0A8B9Y853_BCL2L10      --------------------------------------------------
A0A8B9X9C2_BCL2L1-      ---------------------------------------------SWSRF
A0A8B9WB42_BCL2L1-      ---------------------------------------------SWSQF
A0A8B9XQH5_BCL2L1-      ---------------------------------------------SWSQF
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9WT05_BCL2L2-      --------------------------------------------------
A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      PTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEA
A0A8B9W7D1_MCL1-03      PTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEA
A0A8B9W7D1_MCL1-01      PTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEA
                                                                          

A0A4P8GLJ2_BCL2-01      --------AGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAG
A0A8B9Y853_BCL2L10      --------------------------------TPAPA-------------
A0A8B9Y853_BCL2L10      --------------------------------TPAPA-------------
A0A8B9X9C2_BCL2L1-      NDVEENRTEASEGTKSDMETP-----------MPSMTTHLATGHSRSLDA
A0A8B9WB42_BCL2L1-      S--------------VRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDA
A0A8B9XQH5_BCL2L1-      SDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDA
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9WT05_BCL2L2-      ----------------------------------------VCGAGP----
A0A8B9W7D1_MCL1-04      ----------------------------------------ATGAKDAKPL
A0A8B9W7D1_MCL1-02      SNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPL
A0A8B9W7D1_MCL1-03      SNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPL
A0A8B9W7D1_MCL1-01      SNNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPL
                                                                          

A0A4P8GLJ2_BCL2-01      PAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV
A0A8B9Y853_BCL2L10      ----PSTPEAA-VLRHVAA----RIQEANRNVLPLYRRCRRHRVELVARM
A0A8B9Y853_BCL2L10      ----PSTPEAA-VLRHVAA----RIQEANRNVLPLYRRCRRHRVELVARM
A0A8B9X9C2_BCL2L1-      WKVIPVTTEKQ-ALREAGND----------DQTSQLHITPGTAYQSFEQM
A0A8B9WB42_BCL2L1-      QKTIPMTTVKQ-ALREASNEFKLRYQQTFSDLMSQLRITPGTACQSFEQV
A0A8B9XQH5_BCL2L1-      REVIPMAAVKQ-ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
A0A8B9YDG7_BCL2A1-      ---------------MAAAVAVSGAKRSLRAELKQ---------------
A0A8B9YDG7_BCL2A1-      --PGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQ
A0A8B9YDG7_BCL2A1-      --PGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQ
A0A8B9YDG7_BCL2A1-      --PGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQ
A0A8B9WT05_BCL2L2-      -GEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
A0A8B9W7D1_MCL1-04      GGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8B9W7D1_MCL1-02      GGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8B9W7D1_MCL1-03      GGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8B9W7D1_MCL1-01      GGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
                                        ..                                

A0A4P8GLJ2_BCL2-01      VEELFRD--GVNWGRIVAFFEFGGVMCV--------------ESVNREMS
A0A8B9Y853_BCL2L10      AQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCR
A0A8B9Y853_BCL2L10      AQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCR
A0A8B9X9C2_BCL2L1-      MYELLQD--GVNWGRIVAFFSFSGALCM--------------ESIDKETQ
A0A8B9WB42_BCL2L1-      INELFRD--RVKWGHVVAFFSFSGTLCM--------------KSIDKEIH
A0A8B9XQH5_BCL2L1-      VNELFRD--GVNWGRIVAFFSFGGALCV--------------ESVDKEMQ
A0A8B9YDG7_BCL2A1-      --------------RLRALSAEERLRQSHLLA----------QKV-----
A0A8B9YDG7_BCL2A1-      VMEKEFEDGIVNWGRIVTIFAFEGILTKKLLG----------KCIASDMD
A0A8B9YDG7_BCL2A1-      VMEKEFEDGIVNWGRIVTIFAFEGILTKKLLG----------KCIASDMD
A0A8B9YDG7_BCL2A1-      VMEKEFEDGIVNWGRIVTIFAFEGILTKKLLG----------KCIASDMD
A0A8B9WT05_BCL2L2-      SDELFQG-G-PNWGRLVAFFVFGAALCA--------------ESVNKEME
A0A8B9W7D1_MCL1-04      MVHVFSD-GVTNWGRIVTLISFGAFVAK--------------HLKSINQE
A0A8B9W7D1_MCL1-02      MVHVFSD-GVTNWGRIVTLISFGAFVAK--------------HLKSINQE
A0A8B9W7D1_MCL1-03      MVHVFSD-GVTNWGRIVTLISFGAFVAK--------------HLKSINQE
A0A8B9W7D1_MCL1-01      MVHVFSD-GVTNWGRIVTLISFGAFVAK--------------HLKSINQE
                                      .: ::                               

A0A4P8GLJ2_BCL2-01      PLVDSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPS------------
A0A8B9Y853_BCL2L10      LLVA----LLCAQFCERHRAWLMANGGWDGFCLFFSHS------------
A0A8B9Y853_BCL2L10      LLVA----LLCAQFCERHRAWLMANGGWDGFCLFFSHS------------
A0A8B9X9C2_BCL2L1-      VLVSQSTTWMATYLNDHLESWIQENGGWDTSVKLCENN------------
A0A8B9WB42_BCL2L1-      VLVSQVTTSMATYLNNHVKPWIQENGGWDTFVELYESN------------
A0A8B9XQH5_BCL2L1-      VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNN------------
A0A8B9YDG7_BCL2A1-      -----------------------------FTHNEYQKSKRVSIFLSMPDE
A0A8B9YDG7_BCL2A1-      -MCKDISYFVAEFITENTGEWIKQNGGW----------------------
A0A8B9YDG7_BCL2A1-      -MCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMPDE
A0A8B9YDG7_BCL2A1-      -MCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMPDE
A0A8B9WT05_BCL2L2-      PLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDG----------AL
A0A8B9W7D1_MCL1-04      SCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVE----------DL
A0A8B9W7D1_MCL1-02      SCIEPLAESITDVLVRSKRDWIVKQRGWVSLF------------------
A0A8B9W7D1_MCL1-03      SCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVE----------DL
A0A8B9W7D1_MCL1-01      SCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVE----------DL
                                                                          

A0A4P8GLJ2_BCL2-01      ------MRPLFD-----FSWLSLKALL-------SLALVGACITLGAYLG
A0A8B9Y853_BCL2L10      ------FQPSWERQLVWFFLSYWTAIIIIYFWIKLSFLHIGPVFLPDVFQ
A0A8B9Y853_BCL2L10      ------FQPSWERQLVWFFLSYWTAIIIIYFWIKLSANMDPAKLVSSQGN
A0A8B9X9C2_BCL2L1-      ------TTTESQKGQERFNSWSLTG---------MT--SAGTALLGLLLN
A0A8B9WB42_BCL2L1-      ------TTNESQKGQERFNSIYTTA---------AVAGLANLISNTKLYS
A0A8B9XQH5_BCL2L1-      ------AAAESRKGQERFNRWFLTG---------MT--VAGVVLLGSLFS
A0A8B9YDG7_BCL2A1-      IETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP--EEIASLPRTSW
A0A8B9YDG7_BCL2A1-      --------------ENGFVKKFETKSGWLTFLEVTGKICETLCRLKQYY-
A0A8B9YDG7_BCL2A1-      IETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP--EEIASLPRTSW
A0A8B9YDG7_BCL2A1-      IETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP--EEIASLPRTSW
A0A8B9WT05_BCL2L2-      EEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------------
A0A8B9W7D1_MCL1-04      -------EGGIRNVLLAFAGVAGVGAGLAYLIR-----------------
A0A8B9W7D1_MCL1-02      --------------------------------------------------
A0A8B9W7D1_MCL1-03      -------EGGIRNVLLAFAGVAGVGAGLAYLIR-----------------
A0A8B9W7D1_MCL1-01      -------EGGIRNVLLAFAVDTRLYTEPADVMVCNLV-------------
                                                                          

A0A4P8GLJ2_BCL2-01      HK------------------------------------------------
A0A8B9Y853_BCL2L10      LFDLRHHWE-----------------------------------------
A0A8B9Y853_BCL2L10      NICVDKKPA-----------------------------------------
A0A8B9X9C2_BCL2L1-      S-------------------------------------------------
A0A8B9WB42_BCL2L1-      KLDQRCPYYVGHSGSDR---------------------------------
A0A8B9XQH5_BCL2L1-      RK------------------------------------------------
A0A8B9YDG7_BCL2A1-      NIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      NIQQPGEDEVLEEALSTVAVCLVMSE------------------------
A0A8B9YDG7_BCL2A1-      NIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
A0A8B9WT05_BCL2L2-      --------------------------------------------------
A0A8B9W7D1_MCL1-04      --------------------------------------------------
A0A8B9W7D1_MCL1-02      --------------------------------------------------
A0A8B9W7D1_MCL1-03      --------------------------------------------------
A0A8B9W7D1_MCL1-01      --------------------------------------------------
                                                                          

A0A4P8GLJ2_BCL2-01      -----------------------------------------
A0A8B9Y853_BCL2L10      -----------------------------------------
A0A8B9Y853_BCL2L10      -----------------------------------------
A0A8B9X9C2_BCL2L1-      -----------------------------------------
A0A8B9WB42_BCL2L1-      -----------------------------------------
A0A8B9XQH5_BCL2L1-      -----------------------------------------
A0A8B9YDG7_BCL2A1-      CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
A0A8B9YDG7_BCL2A1-      -----------------------------------------
A0A8B9YDG7_BCL2A1-      -----------------------------------------
A0A8B9YDG7_BCL2A1-      CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
A0A8B9WT05_BCL2L2-      -----------------------------------------
A0A8B9W7D1_MCL1-04      -----------------------------------------
A0A8B9W7D1_MCL1-02      -----------------------------------------
A0A8B9W7D1_MCL1-03      -----------------------------------------
A0A8B9W7D1_MCL1-01      -----------------------------------------
                                                                 

© 1998-2022Legal notice