Dataset for protein BCL-2-like of organism Bos mutus grunniens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------r-----------------m-das-p--rlLaadylsyklrekg-------------------------------
mmfglk-nqviglnlycggaglgq-t---s-gg-r-vvgfektvrsqvqygeagtviggsagpsppatlapdarrvarps
krelagmsasnrtgrgrtpgrg agsgtefgyvhg -e-k-a-a-qiq-g                              
 fi q kryaqk           mavppfrertae l- -v-f-a---                                
       g                     a d  -  m   e c   p                                
                                  a      g                                      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrpavrplpllvwsasnnspgsdgs
                                                                  sgeqfsdveenrte
                                                                     r          
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        ..                      
------------------------------------------sgtpstkalqvlrrvgdgvqrrherafqgmlrklditp
lpstpppaeeepdelyrqsleiisqypreqatgakdakplgg---tprpiset-qeaass---nvqttlsdltsqfrvkn
asegtksdmgteswisgnpswhltpslavngatghsrsldawpvskmstekram-d saefedeyre-nrqcmdlyhrvs
     evry n qa n  a    adamtthvc  gp  s  rkti----vaa-  h  n-avl-i--s-knvap ---cr
                       m      l          qe pavda---   m   v ktg-kq  -aq k    --
                                              aa lh    a   d  s f      e a      
                                                                a               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .: ::                                                   
gddvqslsrvmvelfsd-gvvnWGRivtlfsFggflck--------------ksvskdme-lveplaesmadylveskrd
etaaktffqqvmhvlfed-gts--hvaafiaeeaivamkllgttrrqekrddhlidinqdscis-i--wittvitrrtge
vhtyrlienmaqrker- pip-   lrsivt srarterppq          eckasecrvmckq-syfvceffndnlep
r-r-e-va---n---qg  --k       sv a s lvh  a          dg -r--ql--advttll-aq-c-hh-a
-s-q-r--  s-   d   r              t qs              qk n- t-p  -rsq --v-- -t--k-
   c   t  iy   -                  l  a                    ih   g          en vas
           d                                                                    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
WivkngGWdgfvefyqvskl--------------------wrqgltrfnpryqtg---------as--------l-----
-lqqqr--vtthnlfhkndrvsiflsmpdeieteeiiegis-nvqlc-igwfwlqsnhmymvkl--pnvegias-prtsw
 -ke--  -f-c-e---e--pe          arrlrkdgiqk-kealasvalvaagladfwrkmtklsaelvlvgslys
  mas   a-s-l-csn-ttt                  nfe-q-vw fls-g--iiiivliivlvaimitvkrntqyfn
  --     sltk  ghgfqn                   -ar r-- ---v- ytlwttvmvftlvgldptif slvlq
  hs     e fa  es aae                     s env vvktt k evl glfcngf h npc  kkqg 
                d   a                         g trisr    p   ae     c  a    d   
                                                 kd e                           
                                                  a a                           

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
niqqpgedevleealstggldlifvpglgfdkqsnrlgrgkgyydaylkrclqsqdvkpytlalafkeqiclqvpvnend
sldvrkpyy ghsgsdrvavc vmse                                                      
rkcldhkwa                                                                       
lf   chp                                                                        
k                                                                               
                                                                                
                                                                                
                                                                                

       490 
....:....|.
           
-----------
vkvdevlyeds
           
           
           
           
           
           
           
© 1998-2023Legal notice