Dataset for protein BCL-2-like of organism Bos mutus grunniens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------r---------------------------llaadylsyklrqkg-------------------------------
mmfglk-nqvnrlnlycggaglgqmtdasspggrr-vvgfektvrsevqygeagtviggsagpsppatlapdarrvarps
krelagmsasigtgrgrtpgrg agsgtefgyvhgi-m-k-a-a-qiq-g                              
 fiaq tryaqk           mavppfrertae lek-v-f-a---                                
 ah g kg d                   a d  -  -  ie c   p                                
                                  a      h     r                                
                                         g                                      
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrpavrplplswsefsnnspgsdgs
                                                                 lvgqandveenrtea
                                                                 e dr         ag
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        ..                      
------------------------------atg---------sgpttrkal-vlrrvgdgvqrrherafqgmlsklditp
lpstpppaeepedelyrqsleitpsplreq---akdakplggp-tkssvkset-qeaassf--nyrttlsdltrqfhvkn
segaksdmgteswisgnsqwhlisqyavngvpphsrsldawk-isvppeiqram-d sae-edevqe-nrqcsdlyrrvs
pa  evryan qpgnlsp pgradamtttspc ppp sagrevs-sat--hq-  h  n-avl-i--s-knvmp ---cr
d   a  g a aa i  a    m   s hl    ga a  qat  m--pval   q   d stg-kqd -eqak   l--
                                        p e  - d l-    m   v ks f    aae a      
                                             a a       a        a               
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .: ::                                                   
gdavqsfsrvvvelfsd-ggvnWGRivtlfsFggflck--------------ksvskeme-lvepiaesmaeylvrslrd
etdaktlfqqmmhvlred-vts--hvaafiaeeaivavkllgttrrqekrddhlididqdscis-l--witdvinehkge
vhtyrrienmaqrkef- pip-   lrsivt srartmrppq          eckasncrvmckq-syfvctfftdrtep
r-r-elva---n---qg  --k       sv a smleh  a          dg nr--qp--advttll-aq-c-nh-a
-s-r----t s-   d   r          e   v qs              qk -- t-l  -ssql--v-- -t--k-
f  qg  t  iy   -                  t  a                    is   gr         en vht
   c       e                      l                        h   d              as
           d                                                                    
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
WivkngGWdgfvelyqvs-------------------egifr-gltrfnpryqtg---------as--------l-----
-lqqqr--vtthnffhknkrvsiflsmpdlieteeiikpgw-qvqlc-igwsllasnhmymvkl--plvegias-prtsw
 -ke--  -f-c-e-g-e          aee arrlt-desqn-kealasvfwvqagladfwrkmtansaelvlvgslys
  mas   a-s-l-c-n-                  ft--iekq--- flsag--iliivliivllkimitvitntqyln
  --     sltk  shg                  rqts-dr rvw -----kytiwttvmvftvvglgptkr slvfq
  hs     e fa  es                   mrnn as env vwlvt klevl glfcsgf hdnpcf kkqgg
   d     a      p                   aaal      g tvktr    p   ae n   c ac    d   
                d                               sri e                  a    a   
                                                 kd a                           
                                                  a                             

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
niqqpgedevleealstggldlifvpglgfdkqsnrlgrgkgyydaylkrclqsqdvkpytlalafkeqiclqvpvnend
skdvrkpyy ghsgsdrvavc vmse                                                      
rlcldhkwa                                                                       
lf   chp                                                                        
k                                                                               
h                                                                               
                                                                                
                                                                                
                                                                                

       490 
....:....|.
           
-----------
vkvdevlyeds
           
           
           
           
           
           
           
           
© 1998-2022Legal notice