Dataset for protein Bfl1 of organism Bos mutus grunniens

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=236 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMP
DEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTVAVCLVMSE
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=301 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVSIFLSMP
DEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGF
DKQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
>gnl|bcl2dbpro|A0A8B9YDG7_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2A1 (length=201 residues).
MAAAVAVSGAKRSLRAELKQRLRALSAEERLRQSHLLAQKVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCF
IPRYQLQSNHMDMVKLASPEEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
© 1998-2022Legal notice