Dataset for protein Bfl1 of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9YDG7_BCL2A1-      --------------------------------------MAAAVAVSGAKR
A0A8B9YDG7_BCL2A1-      MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVER
A0A8B9YDG7_BCL2A1-      MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVER
A0A8B9YDG7_BCL2A1-      MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKISRVLQDVASSVQDEVER
                                                               .*: . . .:*

A0A8B9YDG7_BCL2A1-      SLRAELKQ-----------------------------RLRALSAEERLRQ
A0A8B9YDG7_BCL2A1-      TLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILT
A0A8B9YDG7_BCL2A1-      TLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILT
A0A8B9YDG7_BCL2A1-      TLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILT
                        :*.  *.:                             *: :: * * :  

A0A8B9YDG7_BCL2A1-      SHLLAQKV---------------------------------FTHNEYQKS
A0A8B9YDG7_BCL2A1-      KKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGW----------
A0A8B9YDG7_BCL2A1-      KKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKS
A0A8B9YDG7_BCL2A1-      KKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWVFTHNEYQKS
                        .:**.: :                                          

A0A8B9YDG7_BCL2A1-      KRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP-
A0A8B9YDG7_BCL2A1-      --------------------------ENGFVKKFETKSGWLTFLEVTGKI
A0A8B9YDG7_BCL2A1-      KRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP-
A0A8B9YDG7_BCL2A1-      KRVSIFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASP-
                                                  :. *: .:: :*..: :::::.  

A0A8B9YDG7_BCL2A1-      -EEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLG
A0A8B9YDG7_BCL2A1-      CETLCRLKQYY---------------------------------------
A0A8B9YDG7_BCL2A1-      -EEIASLPRTSWNIQQPGEDEVLEEALSTVAVCLVMSE------------
A0A8B9YDG7_BCL2A1-      -EEIASLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLG
                         * :. * .                                         

A0A8B9YDG7_BCL2A1-      RGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLY
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      --------------------------------------------------
A0A8B9YDG7_BCL2A1-      RGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLY
                                                                          

A0A8B9YDG7_BCL2A1-      EDS
A0A8B9YDG7_BCL2A1-      ---
A0A8B9YDG7_BCL2A1-      ---
A0A8B9YDG7_BCL2A1-      EDS
                           

© 1998-2022Legal notice