Dataset for protein Bfl1 of organism Bos mutus grunniens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       .*: . . .:*:*.  *.:                      
mtdtefgyvhglaedylkyvlqiqqpgskpskisrvlqdvAssvqdeveRtLkqcLdkfdvvsvdtartifnqvmekefe
--------------------------------------ma avavsgak s rae kq----------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *: :: * * :  .:**.: :                                                    
dgivnwgRivtifAfEgiltkkLLgkciasdmdmckdisyfvaefitentgewikqnggw-fthneyqkskrvsiflsmp
------- lrals e rlrqsh  aqkv--------------------------------v-------------------
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .:: :*..: :::::.   * :. * .                               
deieteeiikdifrqgktcFipryqlqSnhmdmvklasp--EeiasLprtswniqqpgedevleealstggldlifvp--
----------------eng vkkfetk gwltflevtgkic tlcr kqyy---------------------------gl
                                                                     vavc vmse  

       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
---------------------------------------------------------------
gfdkqsnrlgrgkgyydaylkrclqsqdvkpytlalafkeqiclqvpvnendvkvdevlyeds
                                                               
© 1998-2022Legal notice