Dataset for protein BCL-2-like of organism Athene cunicularia

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A663M6G8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Athene cunicularia GN=MCL-1 (length=157 residues).
RGRAGARLQTDFCAVVLMRWGFKALVRKGSVMSSLAGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAF
VAKHLKSINQEKCISSLAGIITDALISSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|A0A663MPN9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Athene cunicularia GN=BCL-2 (length=212 residues).
MQEYNGSDFTWLTNPLAYLPAIRSSPTAHRTFPSLSHRHDALQHLSSLRAARRPCRAAAPRPRRIVHLALRQAGDEFSRR
YQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHN
WIQDNGGWDAFVELYGNSVRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A663N622_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Athene cunicularia GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMQEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AIFIAVFSLFREYY
© 1998-2020Legal notice