Dataset for protein BCL-2-like of organism Athene cunicularia

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         ::*  :      :   : .      . . ::                                 **:    
------ynttdFyyvyy-rwgylqyvrs----gsvqtslah-------------------------------vLRq----
rgrmqerlqse twlvnmpqdfkplilqsstlhrtmsrvsgrhdalqhlsslraarrpcraaaprprrivhlm  nigss
   agameg ca tllala  aa  kepha pafp                                   a  kaade

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:. . :  :  .                  *    * **  ****::::: **..:     .   .      ..::  :*
lsrqyeedlrsvsg----t------r----VvqevFsDGvtNWGRivtlftFGgvvtkklvsrnvs---plvssiaywiT
fqirtqrafqqmlerlhl-svtvrk-ivng mehl r  n-    vmaiis  almcvhsqnigqqltgkekeqlsgim 
 ed k    apfcdqidi pfaaag ffa  aa k a           f e   fla e keheme   eci  af  

       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
: :     :*:  :***: .*:  :          . *: *: ::        :.             
eylisskreWiqsnGGWe-gFvtlf------g--rrvLmsFswitlltisvlylvr------------
dainrnlhn lmdq   dna lekyrvedle-ssvns ld akvsgkgalsfvmigeyytlgaylghk
    nh a   da         df e      ni  p fa  g aaif alas f aci         
© 1998-2020Legal notice