Dataset for protein BCL-2-like of organism Athene cunicularia

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A663MPN9_BCL2-01      ---MQEYNGSDFTWLTN-PLAYLPAIRSSPTAHRTFPSLSHRHDALQHLS
A0A663M6G8_MCL1-01      RGRAGARLQTDFCAVVLMRWGFKALVRK----GSVMSSLAG---------
A0A663N622_BCL2A1-      ------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH---------
                                 ::*  :      :   : .      . . ::          

A0A663MPN9_BCL2-01      SLRAARRPCRAAAPRPRRIVHLALRQAGDEFSRRYQRDFAQMSGQLHLTP
A0A663M6G8_MCL1-01      ----------------------MLRK----LEIQKEEDLQSVCE------
A0A663N622_BCL2A1-      ----------------------VLRNIASSLQDQTEEALRPFLDRIDITS
                                               **:    :. . :  :  .        

A0A663MPN9_BCL2-01      FTARGRFVA-VVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMS---P
A0A663M6G8_MCL1-01      ----------VAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQE---K
A0A663N622_BCL2A1-      VAVAKRIFNGVMQEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGE
                                  *    * **  ****::::: **..:     .   .    

A0A663MPN9_BCL2-01      LVDSIAAWMTEYLNRHLHNWIQDNGGWD-AFVELY------GNSVRPLFD
A0A663M6G8_MCL1-01      CISSLAGIITDALISSKREWLMSQGGWE-GFVDFFRVEDLEGSIRNVLMA
A0A663N622_BCL2A1-      EKEQISYFITEYIINNKAEWIDANGGWENGFLTKFE--------RRSLLS
                          ..::  :*: :     :*:  :***: .*:  :          . *: 

A0A663MPN9_BCL2-01      FSWISLKTILSLVLVGACITLGAYLGHK
A0A663M6G8_MCL1-01      FAGVAGLGASLAYMIR------------
A0A663N622_BCL2A1-      FSKITAIFIAVFSLFREYY---------
                        *: ::        :.             

© 1998-2020Legal notice