Dataset for protein BCL-2-like of organism Anser brachyrhynchus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B9BNC2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anser brachyrhynchus GN=MCL-1 (length=331 residues).
MKIRGGKKKRGKIGEKCKAPVRGGDGGGTAPPPRLPPARGEEATVTTEGEKQQEQLRDATAAWSGVTYPCGGAQGLFFWG
GGSDGVALRQEGLRQLSCVPEGAGENPGGLQVGRATFARCSSPSFVGGGSEAPPYPPIGCWGPLGTRGPIPLCRAAPAPQ
HFSAEQPGGLPPPLSPPAGGDGGKSWNLFTYLFLPGVLLRAPVSEPASLAGMLRKLEIKKEEDLQSVGEVAAHVFSDGVT
NWGRVVTLISFGAFVAKHLKSIKQEKCIGSLARIITDALVSSKREWLLSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVA
GLGASLAYMIR
>gnl|bcl2dbpro|A0A8B9C4H4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anser brachyrhynchus GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEA
PPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8B9CUX0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anser brachyrhynchus GN=BCL2L1 (length=230 residues).
MSGSNRDLVIDFVSYKLSQKGYSWSQLEEEEDENRTDFAAEADTDGVLNGSPSWHPPASQVVNGAAVHRSSLEVHEIVRS
AAVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRVVAFFSFGGALCVESVDKEMRVLV
GRIVAWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9CVY0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anser brachyrhynchus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DIFVALFSLFREYY
© 1998-2022Legal notice