Dataset for protein BCL-2-like of organism Anser brachyrhynchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9BNC2_MCL1-01      MKIRGGKKKRGKIGEKCKAPVRGGDGGGTAPPPRLPPARGEEATVTTEGE
A0A8B9CVY0_BCL2A1-      --------------------------------------------------
A0A8B9C4H4_BCL2-01      ---------------------------------------------MAHPG
A0A8B9CUX0_BCL2L1-      --------------------------------------------------
                                                                          

A0A8B9BNC2_MCL1-01      KQQEQLRDATAAWSGVTYPCGGAQGLFFWGGGSDGVALRQEGLRQLSCVP
A0A8B9CVY0_BCL2A1-      ------METAEFYYVYY--------------------LAQDYLQYVLQES
A0A8B9C4H4_BCL2-01      RRGYDNREIVLKYIHYK--------------------LSQRGYDWAAGED
A0A8B9CUX0_BCL2L1-      -MSGSNRDLVIDFVSYK--------------------LSQKGYSWSQLEE
                               : .  :                        * *          

A0A8B9BNC2_MCL1-01      EGAGENPGGLQVGRATFARCSSPSFVGGGSEAPPYPPIGCWGPLGTRGPI
A0A8B9CVY0_BCL2A1-      --------------------------------------------------
A0A8B9C4H4_BCL2-01      RAPAPTA--LAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEAPPG
A0A8B9CUX0_BCL2L1-      EEDENRTDFAAEADTDGVLNGSPSWHPPASQVV------NGAAVHRSSLE
                                                                          

A0A8B9BNC2_MCL1-01      PLCRAAPAPQHFSAEQPGGLPPPLSPPAGGDGGKSWNLFTYLFLPGVLLR
A0A8B9CVY0_BCL2A1-      -HLGPAQTRVAHVLRNIAS------------------------------S
A0A8B9C4H4_BCL2-01      EGLRPAPPVVHLALRQAGD------------------------------E
A0A8B9CUX0_BCL2L1-      VHEIVRSAAVRQALREAGD------------------------------E
                               .       : ..                               

A0A8B9BNC2_MCL1-01      APVSEPASLAGMLRKLEIKKE-EDLQSVGEVAAHVFSDGVTNWGRVVTLI
A0A8B9CVY0_BCL2A1-      LQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFADGNTNWGRIMTIF
A0A8B9C4H4_BCL2-01      FSRRYQRDFAQMSGQLHLTPF-TARGRFVAVVEELFRDG-VNWGRIVAFF
A0A8B9CUX0_BCL2L1-      FELRYRRAFSDLTSQLHITPG-TAYQSFEQVVNELFRDG-VNWGRVVAFF
                                :  :  .: :.        .  *    * ** .****:::::

A0A8B9BNC2_MCL1-01      SFGAFVAKHLKSIKQEKC---IGSLARIITDALVSSKREWLLSQGGWEG-
A0A8B9CVY0_BCL2A1-      TFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENG
A0A8B9C4H4_BCL2-01      EFGGVMCVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWDA-
A0A8B9CUX0_BCL2L1-      SFGGALCVESVDKEMRVL---VGRIVAWMTTYLTDHLDPWIQENGGWER-
                         **. :     .            :   :*  :      *:  :***:  

A0A8B9BNC2_MCL1-01      FVDFFRVEDLEGSIR------------NVLMAFAGVAGLGASLAYMIR--
A0A8B9CVY0_BCL2A1-      FLTKFER--------------------RSLLSFSKITDIFVALFSLFREY
A0A8B9C4H4_BCL2-01      FVELYGNSM-------RPLFDFSWISLKTILSLVLVGACITLGAYLGHK-
A0A8B9CUX0_BCL2L1-      FVDLYGNDAAAEVRKGQETFN------KWLLTGATVAGVLLLGSLLSRK-
                        *:  :                      . :::   :         : .  

A0A8B9BNC2_MCL1-01      -
A0A8B9CVY0_BCL2A1-      Y
A0A8B9C4H4_BCL2-01      -
A0A8B9CUX0_BCL2L1-      -
                         

© 1998-2022Legal notice