Dataset for protein BCL-2-like of organism Anser brachyrhynchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                         : .  :                 
                                             maegekqqgql  iaedfsh t             
                                                   mged   a aa ig               

        90       100       110       120       130       140       150       160
       * *                                                                   .  
ggsdgva r kylrysqlvp-gpgpttgg--v-r-tv-rn----w-r---qvvpyppppnw--vstss-ivleivrstrq
        a e  qqllg eredenrpdfaqpgdtdgvlcst  rvpggglls h eiggsgplhrrplgpgcga qp
          d  d aac d aaaena    e a af aa    f g   eap      cg  ageag ee       

       170       180       190       200       210       220       230       240
     : ..                                       :  :  .: :.        .  *    * ** 
rlvaenpaslppplsppaggdggkswnlftylflpgvllslqrstqesfspltrrielksgdvdrrrvng mehv s  v
ahs  ei g                              raplqepad rgfsgk d  kf e lgi ge ad k a  n
 f                                       ed  e    d  d      e   k   ea  a       

       250       260       270       280       290       300       310       320
.****::::: **. :     .            :   :*  :      *:  :***:  *:  :               
t    imalit  alvtkklqnkkvrptgeekerlvyii taitrskhp lleq   dng ltkfrvsmlegvrrgrptf
        i e   fma h keigqqlc   idq srf   nnn dn  dd       ef eredaaesik qel 
              a      dh  ek                id  a    a            da           

       330       340       350 
       . :::   :         : .   
d      nt  agsk gaigla fl g e  
        s     g   cfa     f    
© 1998-2023Legal notice