Dataset for protein BCL-2-like of organism Anas zonorhyncha

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B9UYC3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL-2 (length=347 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEA
PPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWVRAPCFAFLLRWPVAGVALGLTGVHVCSPRCEPRDVRFACCIFAP
VWAFCWLLCCRVSPHGGAAVKQCWFLSGGEQLQLPPQVLKGQARCPLHRRAPLSHPLHPPVASALAKACSSTAWEGVTES
GDGYRGWQVLDVDIPACWGDACVGTRC
>gnl|bcl2dbpro|A0A8B9UZT1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2A1 (length=172 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DLFVAVFSLFRE
>gnl|bcl2dbpro|A0A8B9V5I0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2L1 (length=227 residues).
MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDENRTELASEAAAVLNGSPSWHPPAGQVVNGAAVHRSSLEVHELVQSAAV
RQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VAWMTTYLSDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9VGG9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anas zonorhyncha GN=MCL-1 (length=273 residues).
GGWGTESWRNTSWPSKGPARSDHLGSVLWKSEASSQGPARIDHFGSVPWNSEASPRGVVGTAHFGSVLWNSEASPWGWGG
TDHFGAVFPEPSSGISFRPARTNPLGSAPWGRGGDLTILGWFHPTQKRAPEPAGGETPPLPQQDVALLKNAKGMLRKLEI
KKEEDLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVD
FFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice