Dataset for protein BCL-2-like of organism Anas zonorhyncha

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9UYC3_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAV
A0A8B9UZT1_BCL2A1-      --------------------------------------------------
A0A8B9V5I0_BCL2L1-      ------MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDEN-------RTEL
A0A8B9VGG9_MCL1-01      ------GGWGTESW-----------RNTSWPSKGPARSDHLGSVLWKSEA
                                                                          

A0A8B9UYC3_BCL2-01      AAAGTPSRHRPAGLLSPHPEPPGSAAASEAPPGEGLRPA-----------
A0A8B9UZT1_BCL2A1-      ------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRV-----------
A0A8B9V5I0_BCL2L1-      ASEA-AAVLN--GSPSWHPPA------GQVVNGAAVHRS-----------
A0A8B9VGG9_MCL1-01      SSQG-PARIDHFGSVPWNSEASPRGVVGTAHFGSVLWNSEASPWGWGGTD
                                          .             *                 

A0A8B9UYC3_BCL2-01      -----------------------------------------PPVVHLALR
A0A8B9UZT1_BCL2A1-      --------------------------------AHVLRNIASSLQDQTEE-
A0A8B9V5I0_BCL2L1-      --------------------------------SLEVHELVQSAAVRQALR
A0A8B9VGG9_MCL1-01      HFGAVFPEPSSGISFRPARTNPLGSAPWGRGGDLTILGWFHPTQKRAPEP
                                                                 .   .    

A0A8B9UYC3_BCL2-01      QAGD-----EFSRRYQRDFAQMSGQLHLTP-FTARGRFVAVVEELFRDGV
A0A8B9UZT1_BCL2A1-      -----------------ALRPFLDRIDISSVDVAKRIFNGVMDEKFADGN
A0A8B9V5I0_BCL2L1-      EAGD-----EFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV
A0A8B9VGG9_MCL1-01      AGGETPPLPQQDVALLKNAKGMLRKLEIKK-EEDLQAVGEVAAHLFSDGV
                                             :  .: :.        .  *    * ** 

A0A8B9UYC3_BCL2-01      -NWGRIVAFFEFGGVMCVESVNREMSPL---VDSIAAWMTEYLNRHLHNW
A0A8B9UZT1_BCL2A1-      TNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEW
A0A8B9V5I0_BCL2L1-      -NWGRIVAFFSFGGALCVESVDKEMRVL---VGRIVAWMTTYLSDHLDPW
A0A8B9VGG9_MCL1-01      TNWGRVVTLISFGAFVARHLKSVKQEKS---IGSLARIITDALVSSKREW
                         ****:.::: **. :     .            :   :*  :      *

A0A8B9UYC3_BCL2-01      IQDNGGWV----------------RAPCFAFLLRWPVAGVALGLTGVHVC
A0A8B9UZT1_BCL2A1-      IDANGGWENGFLTKFE--------RRSLLSF----------SKITDLFVA
A0A8B9V5I0_BCL2L1-      IQENGGWE-RFVDLYG-NDAAAEMRKGQETFNKWLLTGATVAGVLLLGSL
A0A8B9VGG9_MCL1-01      LVSQGGWE-GFVDFFRVEDLEGSIRNVLMAF----------AGVAGLGAS
                        :  :***                 *    :*            :  :   

A0A8B9UYC3_BCL2-01      SPRCEPRDVRFACCIFAPVWAFCWLLCCRVSPHGGAAVKQCWFLSGGEQL
A0A8B9UZT1_BCL2A1-      VFSLFRE-------------------------------------------
A0A8B9V5I0_BCL2L1-      LSRK----------------------------------------------
A0A8B9VGG9_MCL1-01      LAYMIR--------------------------------------------
                                                                          

A0A8B9UYC3_BCL2-01      QLPPQVLKGQARCPLHRRAPLSHPLHPPVASALAKACSSTAWEGVTESGD
A0A8B9UZT1_BCL2A1-      --------------------------------------------------
A0A8B9V5I0_BCL2L1-      --------------------------------------------------
A0A8B9VGG9_MCL1-01      --------------------------------------------------
                                                                          

A0A8B9UYC3_BCL2-01      GYRGWQVLDVDIPACWGDACVGTRC
A0A8B9UZT1_BCL2A1-      -------------------------
A0A8B9V5I0_BCL2L1-      -------------------------
A0A8B9VGG9_MCL1-01      -------------------------
                                                 

© 1998-2022Legal notice