Dataset for protein BCL-2-like of organism Anas zonorhyncha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    .           
-------g-gnre------------rgysw---e--------------e-as-g-partr-fgsvswhpea----v-gea
mahpgrr-y----wvlkyvsyklsq-----ssl-prrsnptgsvpwrt-v--q-t-svlnp-yypyynsqpypsy-vstv
      mswdtesl idfih     kntd pqkgeedpdhlalalaksalsaea ameidha llpplapdslrgalqqs
      g s    i                aag daaea       aa a  a     hae          pgqa a   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *                                                          .   .              
hpGsalwrs--------------------------------------------l-------stqvrtalr-agd-----e
vn pvvtpveaspwgwggtdhfgavfpepssgisfrpartnplgsapwgrggs-vvrnwvsppvkqqpe-q---tpplp-
pl egqrna                                           dhtllglfq ladhle peg e     q
 f a  h                                             a eiheiah a   a   a         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :  .: :.        .  *    * **  ****:.::: **. :     .            :   :*
f--ry-rafsqmlsqlhitp-gtayqsfvqVvnelFrDGv-NWGRivtffsFGgvlcvesvsvemsvl---vgsiaawmT
-sv--r-nlrpltrrielssvfvdrrrvng mehk s  nt    vtalit  alvtrklqnrkvrptgekkerlvyii 
qeralqkdakgfsgk d kk ee lgi ge ad   a           i e   fmakh kekgqqls   idq srf  
 dl  l   ad  d       d  k a ea  a                     a      dh  ek             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :      *:  :***                 *    :*            :  :                       
eylvshlreWiqsnGGWe-gfvd-f---------RrvlmaF----------agvtglgvslsrm-r--------------
taisrskhp lveq   vn----l-rvndlegsm nsqlt nlwwpvggvvsklllvhslvpyli-rdvrfaccifapvw
 nnn dn  dd      r ltkyg e aaaei kpcfs lkrlltaatal iad facsfskfpe             
   id  a    a          f e         ag e                    a a ce               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
afcwllccrvsphggaavkqcwflsggeqlqlppqvlkgqarcplhrraplshplhppvasalakacsstawegvtesgd
                                                                                
                                                                                

       410       420     
....:....|....:....|....:
                         
-------------------------
gyrgwqvldvdipacwgdacvgtrc
                         
                         
© 1998-2022Legal notice