Dataset for protein BCL-2-like of organism Amazona collaria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9FJB5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Amazona collaria GN=BCL2A1 (length=174 residues).
METADFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSRLSFSKIT
AMFIAVFTLFREYY
>gnl|bcl2dbpro|A0A8B9FKI5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amazona collaria GN=BCL2L1 (length=433 residues).
MCPVRPALAARTRRFAAERGASGVGGAVPGAGGARVTPRLPSHRAPLGAAVTLGNAACPLPPAAVGQRRRRGAGGAELFN
GRGGGGAASASAALRDWRSAAGPVRSHRSARAASRSPARPGPARSRLPAPGEARGLPGVQVRCSHRRCRRRAGSGAAECR
SVRAPDHGLIEGVPGVKMSSSNRALVIDFVSYKLSQKGHSWSQLEEEDESRTDFAAEEVEMDGVLNGSPSWHPPASHVVN
GAAMHRSSLQVHNTVQAADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSF
GGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEALRPRQHFSHQLPHWGAPGSGGRR
CPPPRLLQVTWKRINRLIFACVSACVCVDVSLI
>gnl|bcl2dbpro|A0A8B9GMI8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Amazona collaria GN=MCL-1 (length=266 residues).
MFALKRKAVIGLNLYCGGSPAPPPPSPAAWAAGCSEALLGCGPVPLRSPEEELDGCEPEPERGPAAAPLPGGAPDALRQA
SLELIGRYLREAAGEAQPAPKKLFPGLLCGPGRPRGAADSGLEKALETLRRLGDSVLRKHELAFQGMLRKLEIQKEEDLQ
AVHEVAARLFSDGVTNWGRVVTLISFGAFVAKHLKSIRQEQCIGSLAGIITDALLSSSREWLLSQGGWEGFVDFFHVEDL
EGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice