Dataset for protein BCL-2-like of organism Amazona collaria

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            ::: 
---------------------------------------------------------------------r--viganlyy
mcpvrpalaartrrfaaergasgvggavpgaggarvtprlpshraplgaavtlgnaacplppaavgqrr-rgmgtleffn
                                                                mfalk kaae  d  c

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g--------------------------------s--p--p-pa-----------g---v--r---------------e--
-rggggaasasaalrdwrsaagpvrshrsarag-rs-pr-s--rwrlpcsgelr-lpp-qv-sshrrlrrragsggc-pr
                                a pa ap g  asaagapeaal cgg pl cpeeec      daa ce

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        *   ::     :                                   :  . :   
--r-p------g---------vyyLvqdylsyvlses----------------------------------hpppsq---
sv-g-dhgplp-vppvkmssssre iirfvrekaqqkghswsqleeedesrtdfaaeevemdgvlngspswqlgakkvvp
pe a aaalie gagdalrqanla ag   q a g a                                    a ahlfn

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .  .**  ....  .   *:  :  .: *      : . : *    * **  ****:::::
g----------------trvrqvLRrlgdsvqrryerAfspmlsrlhItsvtvyqsvhq-VvnelFsDGvtNWGRivtlf
-llmhrssprvhntvqlekalht  niaselllqtrl lrgltrqie qpgedlkrifng merk r  n-    vmaii
 aacgpgrlqgaadsgaad aea  ea   fedkh e  qdf dk d  keaaa afee  aa   a           f 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:**. :     .            :   :*  : .    *:  :****  *:  :         *               
sFGglltkklvskrvr---vlvgsivywiTtyltsssreWiqsnGGWE-gFvdlfh--------Rr--------------
t  afvcvhsqeigqqltgqekerlssim eailnnldp lleq    nr ltkygvedlegsl prqhfshqlphwgap
    a a e kdheme   eci q agf   idhka   da          f endaaaeai n              

       410       420       430       440   
....:....|....:....|....:....|....:....|...
                      : *: ::.       ::    
--------------------vrlsFakvtamvivvvylir---
gsggrrcppprllqvtwkrislmi sgisglgcslftmf-eyy
                    n  a  c a cfaadas      
© 1998-2022Legal notice