Dataset for protein BCL-2-like of organism Amazona collaria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9FKI5_BCL2L1-      MCPVRPALAARTRRFAAERGASGVGGAVPGAGGARVTPRLPSHRAPLGAA
A0A8B9FJB5_BCL2A1-      --------------------------------------------------
A0A8B9GMI8_MCL1-01      --------------------------------------------------
                                                                          

A0A8B9FKI5_BCL2L1-      VTLGNAACPLPPAAVGQRRRRGAGGAELFNGRGGGGAASASAALRDWRSA
A0A8B9FJB5_BCL2A1-      ----------------------METADFYY--------------------
A0A8B9GMI8_MCL1-01      --------------MFALKRKAVIGLNLYCG-------------------
                                                  :::                     

A0A8B9FKI5_BCL2L1-      AGPVRSHRSARAASRSPARPGPARSRLPAPGEARGLPGVQVRCSHRRCRR
A0A8B9FJB5_BCL2A1-      --------------------------------------------------
A0A8B9GMI8_MCL1-01      ------------GSPAPPPPSPAAWAAGCSEALLGCGPVPLRSPEEEL--
                                                                          

A0A8B9FKI5_BCL2L1-      RAGSGAAECRSVRAPDHGLIEGVPGVKMSSSNRALVIDFVSYKLSQKGHS
A0A8B9FJB5_BCL2A1-      -------------------------------VYYLAQDYLQYVLQES---
A0A8B9GMI8_MCL1-01      ----DGCEPEPERGPAAAPLPGGAPDALRQASLELIGRYLREAAGEA---
                                                          *   ::     :    

A0A8B9FKI5_BCL2L1-      WSQLEEEDESRTDFAAEEVEMDGVLNGSPSWHPPASHVVNGAAMHRSSLQ
A0A8B9FJB5_BCL2A1-      -------------------------------HLGPAQ-------------
A0A8B9GMI8_MCL1-01      -------------------------------QPAPKKLFPGLLCGPGRPR
                                                       :  . :             

A0A8B9FKI5_BCL2L1-      VHNTVQAADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQ-
A0A8B9FJB5_BCL2A1-      -------TRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNG
A0A8B9GMI8_MCL1-01      GAADSGLEKALETLRRLGDSVLRKHELAFQGMLRKLEIQKEEDLQAVHE-
                                 .  .**  ....  .   *:  :  .: *      : . : 

A0A8B9FKI5_BCL2L1-      VVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMR---VLVGRIVSWMT
A0A8B9FJB5_BCL2A1-      VMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFIT
A0A8B9GMI8_MCL1-01      VAARLFSDGVTNWGRVVTLISFGAFVAKHLKSIRQE---QCIGSLAGIIT
                        *    * **  ****::::::**. :     .            :   :*

A0A8B9FKI5_BCL2L1-      TYLTDHLDPWIQENGGWE-RFVDLYGNDAAAEALRPRQHFSHQLPHWGAP
A0A8B9FJB5_BCL2A1-      EYIINNKAEWIDANGGWENGFLTKFE--------RR--------------
A0A8B9GMI8_MCL1-01      DALLSSSREWLLSQGGWE-GFVDFFHVEDLEGSIRN--------------
                          : .    *:  :****  *:  :         *               

A0A8B9FKI5_BCL2L1-      GSGGRRCPPPRLLQVTWKRINRLIFACVSACVCVDVSLI----
A0A8B9FJB5_BCL2A1-      --------------------SRLSFSKITAMFIAVFTLFREYY
A0A8B9GMI8_MCL1-01      --------------------VLMAFAGVAGLGASLAYMIR---
                                              : *: ::.       ::    

© 1998-2022Legal notice