Dataset for protein Bax of organism Cavia porcellus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A286Y2U9_BAX-02 BCL2-associated X protein OS=[Eukaryota] Cavia porcellus GN=BAX (length=74 residues).
MDGSGEHPRGSGPTSSEHIMKTGALLLQGMIAAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKLVLK
>gnl|bcl2dbpro|A0A286Y2U9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cavia porcellus GN=BAX (length=192 residues).
MDGSGEHPRGSGPTSSEHIMKTGALLLQGFIQDRAGRMGGDTLELAMEPAPQDASTKKLGECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRDRLLSWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
© 1998-2020Legal notice